SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079912 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079912
Domain Number 1 Region: 548-671
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-17
Family Pleckstrin-homology domain (PH domain) 0.0084
Further Details:      
 
Domain Number 2 Region: 96-260
Classification Level Classification E-value
Superfamily ARM repeat 0.00000733
Family HspBP1 domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079912   Gene: FBgn0032409   Transcript: FBtr0080330
Sequence length 724
Comment type=protein; loc=2L:join(12097951..12098062,12098356..12099366,12099427..12099978,12100042..12100541); ID=FBpp0079912; name=Ced-12-PA; parent=FBgn0032409,FBtr0080330; dbxref=GB_protein:AAF53164.1,FlyBase:FBpp0079912,FlyBase_Annotation_IDs:CG5336-PA,REFSEQ:NP_609548,GB_protein:AAF53164,FlyMine:FBpp0079912,modMine:FBpp0079912; MD5=000e1c893d3482e5d63c78b332b79d7d; length=724; release=r5.30; species=Dmel;
Sequence
MIPKKTTVKDSHIVKIAVEREDHIAQLINLDQRHPLASKIQEICNGWSISDHQNYALQFY
EPTNRKYVTEKNRNEIKNGSVLQLQYSPSKTACDAMEVLLNGSPQEKALRLKELTSLSTD
HTFALEFIKEKGLDTLIKMIEDGGQTNEDILKYSLASFVELMEHGTVSWEVPENSFVARN
IEIVRNFQKYPTNCGESALSNLENIVMCSNKHVLVAEDIKLQDILRLLQDVNSPVMRQNA
IALLNALFVKADEGRRRTIAQTISAKQFRLALIGNGLGTEMTHQLYVLQTLTLGLLEKRM
RMKMNAQDQDAHEKIKELRRIAFDDNTNALNQNDDHIRRGGGSGAGNVNFSQYYKKLGFK
CDINPAQDFIETPPGILALDCMVYFARNYTQQYAKIVRENSCRADEHECPFGRTSIELVK
VLCDILRIGEPPAEQSGDFQPMFFTHDSPFEEFFCICVITLNRTWKDMRATAEDFSTTFS
VVREQIQRTLKGRPENLDDFRNKIALLTYQQITTLRQQERTSKEECDSTASAIVKLKEKI
SPQILELIKQQRLSFLVEGTHFAKYLRGTRTKDKFWYARLSPNHKVIHYGDCDEKTIPTM
EELPKKLPISEIKQLLEGKECPHMKETRIRKSAVNLAFSITFENMEHSTLDFVAPDESIF
NYWTDGINALLGQPMVSKQKNEDFDTLLSMEIKLRLLDTEGVDISKDPPPIPEDPENYDF
CFES
Download sequence
Identical sequences Q9VKB2
FBpp0079912 NP_609548.1.81976 7227.FBpp0079912 FBpp0079912 FR571 FBpp0079912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]