SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0079920 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0079920
Domain Number - Region: 436-505
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00257
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079920   Gene: FBgn0051760   Transcript: FBtr0080338
Sequence length 1075
Comment type=protein; loc=2L:join(12153528..12153974,12155472..12155658,12160690..12160882,12161245..12161650,12162740..12163041,12163457..12163610,12166727..12166836,12166898..12167042,12167113..12167321,12168120..12168369,12168428..12168612,12168742..12169381); ID=FBpp0079920; name=CG31760-PA; parent=FBgn0051760,FBtr0080338; dbxref=FlyBase:FBpp0079920,FlyBase_Annotation_IDs:CG31760-PA,GB_protein:AAF53174.2,REFSEQ:NP_723730,GB_protein:AAF53174,FlyMine:FBpp0079920,modMine:FBpp0079920; MD5=fa3ef7f794e0c59ac29d014f1c051497; length=1075; release=r5.30; species=Dmel;
Sequence
MKCWHNVVRRRRKKPTAAAAAKGSKGSHGGVASPRDEDAICQRQQQVDTYTWLTTQAVPL
LWLHLLLLVAFAKHAAAATTIATNPEATTTTVSNYTVTTTALSSSTTTTSSGSAPALSSA
ADKFAGNWANLEDSFRNIVRIGDGNTVTRTSIEQSLVTIHDIATENLGTLCISTLYRPLQ
VPINSERYESSRQKTDLAASILQEVGIIRHGGLSDALAKGLLTDDFITGARILALNLTNG
AVQSYVWWVKGTAAEIQRYDEDGLQIGKKPAGSYPWFDDETSSPTLRSPKFAPSPPNNYY
KGWWTYPYFSCSQSRWLVSYSIAIPPIGRHGLRGFISIDIDVSTLRVNQCEAEPYPFGSR
RQKMQQLQTHNRLGARRSLFLGSRMGAIDESTINDLQAFHSSHKCHRTSMVCDYRQPSAE
TPTVTGGKLLTTLTGSSSWTRGSYQCLCRGGFYSLRHPDGFNGTIMEIAWQEQQDNISNY
YSEVFKCLPCAPGCDTCTGPEPCLANYHWPFRISLLTISIGCACGTFVLAGYLFRHRRVK
VFKVASPIFLMITLIGCAIMYLEMVAIFPYLDTTWCIATKWTRHMGFCITYTSLLMKTWR
VSLTYRVKSAHKIKLNDQQLLQWMVPILLVMLIYLGTWTISATPTAEVILDQSQLKFKQC
SYNWWDHSLAIGEVFFLAWGIRVCYNVRNAESLYNEARLISYAIYNIALVNIAMVVFHVM
LFPNAGPDYKYMLGFVRTQLSTTTTIALVFGPKILRVFKGQGDKWDQKAKVRSITASFSL
NGVGLVPEESPDLYQENEELKEQVQKLAHQIEFMKTVHMQMNNRHLKPKPGGYFTITSTS
FQAPYSKNTVSTAQTQTGKDENSVKDCSIEIDGGQGRTTLVEDAIEFNFHLADTEKGLIV
QEDERPGSDEEEAALIAQFRRLFAPILDDSLNLYYQLNDLDDTEHVRIHQTVAQMNDLTS
SEEETMVTQVNSPSPPPVGVELLLPISSDSSTASSSLYAIHTPSPAHPSGVLLMPQNLES
PLLSGSDAITITEQVELHNPPHHLQLLEDENNTSCSLSSNLTDSKTLDGRTPIVV
Download sequence
Identical sequences 7227.FBpp0079920 FBpp0079920 FBpp0079920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]