SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080063 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080063
Domain Number 1 Region: 447-627
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-47
Family Kelch motif 0.00013
Further Details:      
 
Domain Number 2 Region: 327-489
Classification Level Classification E-value
Superfamily Kelch motif 7.98e-42
Family Kelch motif 0.00016
Further Details:      
 
Domain Number 3 Region: 60-180
Classification Level Classification E-value
Superfamily POZ domain 5.97e-31
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080063   Gene: FBgn0032485   Transcript: FBtr0080484
Sequence length 627
Comment type=protein; loc=2L:complement(13217159..13217293,13217361..13217616,13217676..13218520,13218785..13218976,13219037..13219492); ID=FBpp0080063; name=CG9426-PA; parent=FBgn0032485,FBtr0080484; dbxref=FlyBase:FBpp0080063,FlyBase_Annotation_IDs:CG9426-PA,GB_protein:AAF53261.1,REFSEQ:NP_609616,GB_protein:AAF53261,FlyMine:FBpp0080063,modMine:FBpp0080063; MD5=a24241cf358745cdc02560293588ee0c; length=627; release=r5.30; species=Dmel;
Sequence
MPPLKTYQIHEYNGNTSPNANANQNANQNPTGGGGDGDFFGQNLGSGATAASHRTNLPSY
CNAQYPFKVLSNLNQLREQSRFCDVEIIAGMATLSAHRAVLSAASAYFEAMFRPELGLNE
VKQKSVVLHTIDGDILHILLDFIYTGRCEITQSNVQELLAAADMLQLNEVVDGCCEFLCR
ELHASNALGILRFAEAHNCESLAKSALNFVHANFPAVTLEDEFLETPQTLLSQLLNSELL
RVDSESQVFQAALRWIKHDVTQRRCYVFDVLSHVRMALVPVKVIDKALKDDCRDMSVKIA
LRSICRDIASKRGQLVPLRVCPRQLAKKNIYIIGGSHRDTPRTWNSADCIFETVAKFDIF
RREWTETAPMEVGRILPGVSALNGKIYVVGGERGSQILANGEVYDPQNDVWQPIAPMIVP
RCEFGLCTMGGNLFAVGGWIGDDIGGSMECYDPEQDLWKLMGSMPQPRFSMGVVSFEGLI
YIVGGCTTTTRHLPDLISFNPVTKEWNELARMQTARCQMGVAVLDRYLYVVGGSSISQDI
LSSVERYSFDEDKWTTVCALNVPRAIPAVVAADGLLYVAGGDQPCEVNFYRAQVTINAVE
CYDPLSDTWKNCPDLPVSRSEAGAVVV
Download sequence
Identical sequences Q9VK21
7227.FBpp0080063 NP_609616.1.81976 FBpp0080063 FBpp0080063 FBpp0080063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]