SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080103 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080103
Domain Number 1 Region: 210-284
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.93e-24
Family PHD domain 0.0000198
Further Details:      
 
Weak hits

Sequence:  FBpp0080103
Domain Number - Region: 24-79
Classification Level Classification E-value
Superfamily Ribosome recycling factor, RRF 0.00427
Family Ribosome recycling factor, RRF 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080103   Gene: FBgn0032516   Transcript: FBtr0080525
Sequence length 285
Comment type=protein; loc=2L:complement(13385935..13386036,13386099..13386257,13386488..13386690,13386757..13387113,13387177..13387213); ID=FBpp0080103; name=CG9293-PA; parent=FBgn0032516,FBtr0080525; dbxref=FlyBase:FBpp0080103,FlyBase_Annotation_IDs:CG9293-PA,GB_protein:AAF53297.2,REFSEQ:NP_609647,GB_protein:AAF53297,FlyMine:FBpp0080103,modMine:FBpp0080103; MD5=694feea20e76ead98402e4b6b3fa2f41; length=285; release=r5.30; species=Dmel;
Sequence
MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMS
EDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDNDLARFEGEIQEKASS
TRAKSEEVVAKKGRKKTKDSKTTGKKKKSASSDEETGRGNNQSNANSSVNSSSNAGQGSK
KKKSKVNQEKETRKGGAQKKTVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQV
SYGEMIGCDNPDCPIEWFHFACVGLTTKPKGKWFCPKCTQDRKKK
Download sequence
Identical sequences Q9VJY8
FBpp0080103 FBpp0080104 NP_609647.1.81976 FBpp0080103 FR466 7227.FBpp0080103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]