SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080162 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080162
Domain Number 1 Region: 162-286
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000225
Family Growth factor receptor domain 0.0075
Further Details:      
 
Weak hits

Sequence:  FBpp0080162
Domain Number - Region: 261-360
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00994
Family Growth factor receptor domain 0.0051
Further Details:      
 
Domain Number - Region: 88-184
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0209
Family Growth factor receptor domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080162   Gene: FBgn0027929   Transcript: FBtr0080585
Sequence length 402
Comment type=protein; loc=2L:join(13963548..13963738,13963899..13964456,13964535..13964738,13964797..13965052); ID=FBpp0080162; name=nimB1-PA; parent=FBgn0027929,FBtr0080585; dbxref=FlyBase:FBpp0080162,FlyBase_Annotation_IDs:CG33119-PA,GB_protein:AAF53360.2,REFSEQ:NP_788045,GB_protein:AAF53360,FlyMine:FBpp0080162,modMine:FBpp0080162; MD5=80a730275b2a90390e342828ec246d1e; length=402; release=r5.30; species=Dmel;
Sequence
MHCSGPLAGLTALLTLVAFPVQIKTDSTVSTELYGDIENTEYGDFESLSQTRERQQHLCH
REVPSVFFQTERDSPVRGNGSTIYFHRIEVCCAGYRRDPYANECVPDCSASSPDNCRNGF
CRSPGVCECFAEFVRNEHGACIHTCPIACQHGRCYLNGTCVCHQNFVLDQETRQFCRPKC
SQSCGTHEECVAPGQCDCSPGYRRTPDLGCQPVCAPDCGFGKCVAPNQCECFAGFIKRPN
WNVCEAECYLNCENGLCESRYKCHCREGYRYDVNTTSCLPECSDNCGQGNGVCIAPGVCR
CFRGYEVHGAECRPKCERFCGKYGRCVAPEICGCGEGQQHCRNGSCDDIEHCSCPSGETH
FIDRCLKADRLSQHLNTSEKRKHFNRQLAYEFNALIGRLFNF
Download sequence
Identical sequences Q9VJU9
FBpp0080162 NP_788045.1.81976 FBpp0080162 FBpp0080162 7227.FBpp0080162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]