SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080169 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0080169
Domain Number - Region: 76-206
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00113
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080169   Gene: FBgn0260011   Transcript: FBtr0080592
Sequence length 377
Comment type=protein; loc=2L:14047631..14048764; ID=FBpp0080169; name=nimC4-PA; parent=FBgn0260011,FBtr0080592; dbxref=FlyBase:FBpp0080169,FlyBase_Annotation_IDs:CG16876-PA,GB_protein:AAF53372.1,REFSEQ:NP_609698,GB_protein:AAF53372,FlyMine:FBpp0080169,modMine:FBpp0080169; MD5=965cc1eabf5786e9ef58be581fa7df41; length=377; release=r5.30; species=Dmel;
Sequence
MKFIWALILVLGSIAANAERDNYCERNETIRATVPVTKQRIIVKQPSKWKIWKKTEKITE
IYDSEEEQVTHRLVRECCPGYLQVESGLCEPICSRGCPAHASCAAPDRCECISGYVSARN
HQDGSHYCEPICETPCPAGAQCVTPNTCACRDGYTQLQPTDDGVSGGCAPVCRVGDGCAN
GKCIDVDRCACNSGYRWDKAEERCIELSAESISEELETTEDNTDSPSTSSTAVFTATHCP
DDFVLFRGECREKQFDSNDVGCLKSGCGPHQTCLDSGVCQCSDGYVPEESGEATGVLSCR
RTLLDQILGLNEAIDDDDELNPWTIPIIGVACGFLFVLLIVGLLGGRRYRQERAALANKE
MECQYSQKTVDVDEWVP
Download sequence
Identical sequences Q9V392
FBpp0080169 NP_609698.2.81976 7227.FBpp0080169 FBpp0080169 FBpp0080169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]