SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080190 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0080190
Domain Number - Region: 125-234
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00135
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 87-143
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 0.0471
Family Hypothetical protein c14orf129, hspc210 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080190   Gene: FBgn0028542   Transcript: FBtr0080617
Sequence length 448
Comment type=protein; loc=2L:complement(13968343..13968835,13968897..13969460,13969619..13969908); ID=FBpp0080190; name=nimB4-PA; parent=FBgn0028542,FBtr0080617; dbxref=FlyBase:FBpp0080190,FlyBase_Annotation_IDs:CG33115-PA,GB_protein:AAF53361.2,REFSEQ:NP_788046,GB_protein:AAF53361,FlyMine:FBpp0080190,modMine:FBpp0080190; MD5=2969f40b2ecbbce665023ba8a258d1cc; length=448; release=r5.30; species=Dmel;
Sequence
MSTILRSLCLHSVLLVLFLCVLHGLELQLHEQQLQQQKDEQLRLRAEQRQRELLREHEAL
QRRLSSSTTTRKPYIIPNGLSLPRRGEHPDKCRQEVPAVFFQYDKEVKIVGNSSTNPYMN
VIEVCCKGWRRYEYDWSQCVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLG
CPHGRCYLNGTCQCDKGYELDGSRKFCQPQCNATCGHNEVCLEPGKCSCAEGYTRGLRES
AALGCQPICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDCYMTCENGFCANKTTCVC
QNGYRYDKNTTTCLPDCGDNCDNGVCISPGNCRCFKGYVRNRERCEAVCVGGCGFYGKCI
APNVCGCAIVPGPERTYQRCEYGLCNAMGRCRCQVGMTRFIDRCMSPDTVTTYASMNPVK
VNASLIQEFNLLLGRHFNLTTLSDMWWL
Download sequence
Identical sequences Q9VJU8
7227.FBpp0080190 FBpp0080190 NP_788046.1.81976 FBpp0080190 FBpp0080190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]