SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080191 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080191
Domain Number 1 Region: 317-415
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000523
Family Growth factor receptor domain 0.0038
Further Details:      
 
Weak hits

Sequence:  FBpp0080191
Domain Number - Region: 229-318
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000722
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number - Region: 164-256
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00471
Family Growth factor receptor domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080191   Gene: FBgn0028543   Transcript: FBtr0080618
Sequence length 421
Comment type=protein; loc=2L:complement(13965087..13965396,13965475..13966011,13966506..13966924); ID=FBpp0080191; name=nimB2-PA; parent=FBgn0028543,FBtr0080618; dbxref=FlyBase:FBpp0080191,FlyBase_Annotation_IDs:CG31839-PA,GB_protein:AAN10861.1,REFSEQ:NP_723857,GB_protein:AAN10861,FlyMine:FBpp0080191,modMine:FBpp0080191; MD5=14db6174ec117b52c7c4ce70b1307f9d; length=421; release=r5.30; species=Dmel;
Sequence
MRSSSCQLVTLGVLLAICSLGQGQFKTAGIKTRQPPSGNLQLAGNSSESGWRSYNQSSYG
WSTQNQSNYAWNQQNHVEQGSAGFVRAEVFQPVTLPPLYGHYVQPVTPPAHRVQVLDETA
LFINKTRSAMASGVCYKEVPTASLLRNSRDQFVGNGTTPDMSRIQVCCDGYERNPHIYRR
CEPICADDCRNGICTAPNTCVCIPGHVRTAEGKCISTCPLGCGNGVCDERNECKCREGYS
LEPETRKYCQPECKPGCSFGRCVAPNKCACLDGYRLAADGSCEPVCDSCENGKCTAPGHC
NCNAGYLKLQGRCEPICSIPCKNGRCIGPDICECASGFEWDRKSAECLPKCDLPCLNGVC
VGNNQCDCKTGYVRDEHQRNICQPHCPQGCQNGYCSAPNFCICRPGFIKSGIKGRQTCQA
V
Download sequence
Identical sequences Q7KTA1
FBpp0080191 NP_723857.1.81976 7227.FBpp0080191 FBpp0080191 FBpp0080191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]