SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080287 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080287
Domain Number 1 Region: 51-194
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-33
Family Ankyrin repeat 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080287   Gene: FBgn0261881   Transcript: FBtr0080728
Sequence length 215
Comment type=protein; loc=2L:complement(15006645..15007156,15007206..15007341); ID=FBpp0080287; name=l(2)35Be-PA; parent=FBgn0261881,FBtr0080728; dbxref=FlyBase:FBpp0080287,FlyBase_Annotation_IDs:CG4140-PA,GB_protein:AAF53427.1,REFSEQ:NP_609735,GB_protein:AAF53427,FlyMine:FBpp0080287,modMine:FBpp0080287; MD5=2746e7b22a7cdd67cecfb72c162e9da6; length=215; release=r5.30; species=Dmel;
Sequence
MGDYDSDDEKSQVEKLRHAKVPRGMFVSGWDDDADELIEEDKNPQSSIERMILWAVNENR
ISEVREILKLDADTVNAKDNDGYTPLHRAAYNNFVDMAKLLLQYHANPNARTELGWTPLH
SACKWNNADCAHLLLQFGADVNAESDGKQTPLHITATVSNCRNTATVLLLDRYIQPRKEN
NSEELASVIARRTGMSFPIFESGEEAYDCETGLID
Download sequence
Identical sequences Q9V3Y0
NP_609735.1.81976 FBpp0080287 FBpp0080287 7227.FBpp0080287 FBpp0080287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]