SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080424 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080424
Domain Number 1 Region: 352-455
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.4e-29
Family Chaperone J-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 5-100
Classification Level Classification E-value
Superfamily TPR-like 2.2e-26
Family Tetratricopeptide repeat (TPR) 0.00066
Further Details:      
 
Domain Number 3 Region: 236-354
Classification Level Classification E-value
Superfamily TPR-like 1.14e-24
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 
Domain Number 4 Region: 130-233
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000104
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080424   Gene: FBgn0032586   Transcript: FBtr0080867
Sequence length 464
Comment type=protein; loc=2L:join(16497144..16497151,16505496..16505948,16506008..16506852,16506929..16507017); ID=FBpp0080424; name=Tpr2-PB; parent=FBgn0032586,FBtr0080867; dbxref=FlyBase:FBpp0080424,FlyBase_Annotation_IDs:CG4599-PB,GB_protein:AAN10946.1,REFSEQ:NP_723974,GB_protein:AAN10946,FlyMine:FBpp0080424,modMine:FBpp0080424; MD5=ec1dbd7909ddadc467bbfb9826fe832d; length=464; release=r5.30; species=Dmel;
Sequence
MLYIAEEKKKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALT
DARHAIRIDPGFEKAYVRVAKCCLALGDIIGTEQAVKMVNELNSLSTAVAAEQTAAQKLR
QLEATIQANYDTKSYRNVVFYLDSALKLAPACLKYRLLKAECLAFLGRCDEALDIAVSVM
KLDTTSADAIYVRGLCLYYTDNLDKGILHFERALTLDPDHYKSKQMRSKCKQLKEMKENG
NMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNLREAVADCNRVLEL
NSQYLKALLLRARCYNDLEKFEESVADYETALQLEKTPEIKRMLREAKFALKKSKRKDYY
KILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYAILSDAHK
KSRYDSGQDIEEQEQADFDPNQMFRTFFQFNGGGRNNSSFNFEF
Download sequence
Identical sequences Q8IP18
FBpp0080424 FBpp0305672 NP_001260502.1.81976 NP_723974.1.81976 FBpp0080424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]