SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080494 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080494
Domain Number 1 Region: 12-444
Classification Level Classification E-value
Superfamily ARM repeat 3.35e-149
Family Regulatory subunit H of the V-type ATPase 0.0000543
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080494   Gene: FBgn0027779   Transcript: FBtr0080940
Sequence length 468
Comment type=protein; loc=2L:complement(16723819..16723897,16724058..16724171,16724232..16724794,16724859..16724993,16727010..16727488,16727630..16727666); ID=FBpp0080494; name=VhaSFD-PA; parent=FBgn0027779,FBtr0080940; dbxref=FlyBase:FBpp0080494,FlyBase_Annotation_IDs:CG17332-PA,GB_protein:AAF53555.2,REFSEQ:NP_523585,GB_protein:AAF53555,FlyMine:FBpp0080494,modMine:FBpp0080494; MD5=346db55e9e4058481676c6c9c1199730; length=468; release=r5.30; species=Dmel;
Sequence
MTTALYLPEENIDMIAATSVLQQQAADIRTRTINWASYMQSQMISEEDYKAISALDKSRA
SFLAQNSSQVVKTLLNLVSHLSKDSTIQYILVLLDDLLQEDRSRVDLFHDTAGKLKQCIW
GPFLNLLNRQDGFIVNMSSRILAKFACWGHETMPKSDLNFYLQFLKDQLASNNNEYIQSV
ARCLQMMLRVDEYRFAFVGVDGISTLIRILSTRVNFQVQYQLIFCLWVLTFNPLLAAKMN
KFSVIPILADILSDCAKEKVTRIILAVFRNLIEKPEDSSVAKDHCIAMVQCKVLKQLSIL
EQRRFDDEDITADVEYLSEKLQNSVQDLSSFDEYATEVRSGRLEWSPVHKSAKFWRENAQ
RLNEKNYELLRILVHLLETSKDAIILSVACFDIGEYVRHYPRGKHVLEQLGGKQIVMQHL
GHEDPNVRYEALLAVQKLMVHNWEYLGKQLEKENENQKQGAAPIAGKA
Download sequence
Identical sequences M9PDK5 Q9V3J1
FBpp0080494 FBpp0080494 NP_001260510.1.81976 NP_523585.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]