SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080596 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080596
Domain Number 1 Region: 404-683
Classification Level Classification E-value
Superfamily Kelch motif 5.23e-78
Family Kelch motif 0.000000736
Further Details:      
 
Domain Number 2 Region: 135-250
Classification Level Classification E-value
Superfamily POZ domain 1.65e-34
Family BTB/POZ domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080596   Gene: FBgn0001301   Transcript: FBtr0081043
Sequence length 1477
Comment type=protein; loc=2L:complement(18130774..18131520,18131582..18132609,18132963..18133525,18133588..18134826,18135574..18135975,18137477..18137931); ID=FBpp0080596; name=kel-PB; parent=FBgn0001301,FBtr0081043; dbxref=FlyBase_Annotation_IDs:CG7210-PB,FlyBase:FBpp0080596,GB_protein:AAN11182.3,REFSEQ:NP_476589,GB_protein:AAN11182,FlyMine:FBpp0080596,modMine:FBpp0080596; MD5=18d150f49af47a60d8bae6d40d37eb69; length=1477; release=r5.30; species=Dmel;
Sequence
MIALSALLTKYTIGIMSNLSNGNSNNNNQQQQQQQQGQNPQQPAQNEGGAGAEFVAPPPG
LGAAVGVAAMQQRNRLLQQQQQQHHHHQNPAAEGSGLERGSCLLRYASQNSLDESSQKHV
QRPNGKERGTVGQYSNEQHTARSFDAMNEMRKQKQLCDVILVADDVEIHAHRMVLASCSP
YFYAMFTSFEESRQARITLQSVDARALELLIDYVYTATVEVNEDNVQVLLTAANLLQLTD
VRDACCDFLQTQLDASNCLGIREFADIHACVELLNYAETYIEQHFNEVIQFDEFLNLSHE
QVISLIGNDRISVPNEERVYECVIAWLRYDVPMREQFTSLLMEHVRLPFLSKEYITQRVD
KEILLEGNIVCKNLIIEALTYHLLPTETKSARTVPRKPVGMPKILLVIGGQAPKAIRSVE
WYDLREEKWYQAAEMPNRRCRSGLSVLGDKVYAVGGFNGSLRVRTVDVYDPATDQWANCS
NMEARRSTLGVAVLNGCIYAVGGFDGTTGLSSAEMYDPKTDIWRFIASMSTRRSSVGVGV
VHGLLYAVGGYDGFTRQCLSSVERYNPDTDTWVNVAEMSSRRSGAGVGVLNNILYAVGGH
DGPMVRRSVEAYDCETNSWRSVADMSYCRRNAGVVAHDGLLYVVGGDDGTSNLASVEVYC
PDSDSWRILPALMTIGRSYAGVCMIDKPMXMEEQGALARQAASLAIALLDDENSQAEGTM
EGAIGGAIYGNLAPAGGAAAAAAPAAPAQAPQPNHPHYENIYAPIGQPSNNNNNSGSNSN
QAAAIANANAPANAEEIQQQQQPAPTEPNANNNPQPPTAAAPAPSQQQQQQQAQPQQPQR
ILPMNNYRNDLYDRSAAGGVCSAYDVPRAVRSGLGYRRNFRIDMQNGNRCGSGLRCTPLY
TNSRSNCQRQRSFDDTESTDGYNLPYAGAGTMRYENIYEQIRDEPLYRTSAANRVPLYTR
LDVLGHGIGRIERHLSSSCGNIDHYNLGGHYAVLGHSHFGTVGHIRLNANGSGVAAPGVA
GTGTCNVPNCQGYMTAAGSTVPVEYANVKVPVKNSASSFFSCLHGENSQSMTNIYKTSGT
AAAMAAHNSPLTPNVSMERASRSASAGAAGSAAAAVEEHSAADSIPSSSNINANRTTGAI
PKVKTANKPAKESGGSSTAASPILDKTTSTGSGKSVTLAKKTSTAAARSSSSGDTNGNGT
LNRISKSSLQWLLVNKWLPLWIGQGPDCKVIDFNFMFSRDCVSCDTASVASQMSNPYGTP
RLSGLPQDMVRFQSSCAGACAAAGAASTIRRDANASARPLHSTLSRLRNGEKRNPNRVAG
NYQYEDPSYENVHVQWQNGFEFGRSRDYDPNSTYHQQRPLLQRARSESPTFSNQQRRLQR
QGAQAQQQSQQPKPPGSPDPYKNYKLNADNNTFKPKPIAADELEGAVGGAVAEIALPEVD
IEVVDPVSLSDNETETTSSQNNLPSTTNSNNLNEHND
Download sequence
Identical sequences FBpp0080595 FBpp0080596 FBpp0080596 NP_476589.4.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]