SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080598 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080598
Domain Number 1 Region: 216-351
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000157
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080598   Gene: FBgn0032663   Transcript: FBtr0081045
Sequence length 364
Comment type=protein; loc=2L:complement(18090941..18091265,18091469..18092238); ID=FBpp0080598; name=CG15153-PA; parent=FBgn0032663,FBtr0081045; dbxref=FlyBase:FBpp0080598,FlyBase_Annotation_IDs:CG15153-PA,GB_protein:AAF53646.1,REFSEQ:NP_609863,GB_protein:AAF53646,FlyMine:FBpp0080598,modMine:FBpp0080598; MD5=9141f1c766f1a7a3258d3c624cd6130a; length=364; release=r5.30; species=Dmel;
Sequence
MDFHLLMIALVLAPVFTPVHCQVACNARSGPVRQKRIVLSSPGTGGLAELDTCQYRVAPW
SGQVCQVRVDFERLELPQPQLNANSGVLECVDFLQIQHFRLCGRNSGQHLYIPIRRGQEL
QLLFRLATSLGRQSTWQLTLTQLECPRDSARGVGTRQPEVQTPTVRPILPFLGNFLPRTI
FGGQSGIGSGSGPAAQLIQTFTSPSSADLEMLAPLGCDQYYRTTTGGIVSFNFAGGVYMP
NMKYSICVKGAADNEISYKITHFELSKANSEQPGPAYDTDCRSTVLTPLRVSDYVSIPDA
YMVGRPELQATHYCGNGLAGQELVARPPFVLRFASDSQSSGSETGFQLTYTVRRSQDSLV
STDL
Download sequence
Identical sequences Q9VJA6
FBpp0080598 7227.FBpp0080598 FBpp0080598 NP_609863.1.81976 FBpp0080598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]