SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080629 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080629
Domain Number 1 Region: 632-756
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.61e-20
Family N-acetyl transferase, NAT 0.03
Further Details:      
 
Domain Number 2 Region: 7-66
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000036
Family PHD domain 0.021
Further Details:      
 
Weak hits

Sequence:  FBpp0080629
Domain Number - Region: 83-178
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 0.0732
Family Bacterial photosystem II reaction centre, L and M subunits 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080629   Gene: FBgn0032691   Transcript: FBtr0081079
Sequence length 774
Comment type=protein; loc=2L:complement(18609607..18609962,18610029..18611260,18611327..18611501,18611557..18611708,18611769..18612178); ID=FBpp0080629; name=CG10414-PA; parent=FBgn0032691,FBtr0081079; dbxref=FlyBase:FBpp0080629,FlyBase_Annotation_IDs:CG10414-PA,GB_protein:AAF53681.1,REFSEQ:NP_609889,GB_protein:AAF53681,FlyMine:FBpp0080629,modMine:FBpp0080629; MD5=42939f085f8ad43bd82e7f2c371759be; length=774; release=r5.30; species=Dmel;
Sequence
MNRPSNWDDPQGPCRYCESPVEDDNYLECQECRRMVHIKCLPHACTPGDLLGDVFFEFTC
VKCVLDKAKESVIPSDLEPIKEVIVRQRIPWLLVLTLTLYNLSIKQKGLGHHGFFHWRTH
IISFVDKNWNYIFGPNVRRRKQWTGSVSGALSHNSPEYFQSGLDVFQENGWWKLAKPFQT
PRSVLKEYEKKQQLRLQMRIEKRLPAADETSCSSEISVADHAQDNPPLIKAEAEKPSSTE
GCARTIPYMGRLPKIQTQPSPLSQETLPGPPILQENIAPPSQKEEEPQNQPMSMVQAGLM
DFLAESLESDDFTMFGNLPGIMPPPLIGAGKNDFFMTEPLLHAPLNNEGLFDMDTNFAIP
NTADETKPISTEEPAAESSEEQKEGEVEDEKPEEDESPDYQPRIVQVTNYQAQEANESIK
EEPLEEIMQDDDVTTNSKSSILEPCKPSGFVRQPRRNWPWLQEAQDPDDMAIPSENLKLI
NAYEEQKLYQRLDRIFALEHQCHISIPAYVRRLYRKLSLRKWKRDHNRHIFNLDEHIDPL
GRARLKMLGHQKAEILDRYQLLAHSRQDARSSFHARLAGCTQYELFESPYSQRVLHPFIF
RSETMAPPWLKLMCELQHRVNGSHPTRSTIDFCFVRPQHIPAVNALLQSTFWPNIDVSEC
LSYPDYSVVALYKKLVIGCGFLVPDVGYNEAYISFMAVRPCWQRSGIASFMLYHLIQTCM
SKDITLHVSATNAAVMLYQKFGFKMEEIILDFYDKYLPLDSKQSRNAFFLRLQR
Download sequence
Identical sequences Q9VJ73
FBpp0080629 NP_609889.1.81976 FBpp0080629 FBpp0080629 7227.FBpp0080629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]