SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080637 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0080637
Domain Number - Region: 681-826
Classification Level Classification E-value
Superfamily TPR-like 0.00885
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080637   Gene: FBgn0032679   Transcript: FBtr0081087
Sequence length 1412
Comment type=protein; loc=2L:complement(18449634..18450175,18450239..18451960,18452017..18453325,18453392..18453917,18454347..18454486); ID=FBpp0080637; name=bsf-PA; parent=FBgn0032679,FBtr0081087; dbxref=FlyBase:FBpp0080637,FlyBase_Annotation_IDs:CG10302-PA,GB_protein:AAF53668.2,REFSEQ:NP_523596,GB_protein:AAF53668,FlyMine:FBpp0080637,modMine:FBpp0080637; MD5=6c47153da07156e39e45dccb6b84cf1f; length=1412; release=r5.30; species=Dmel;
Sequence
MASILRTGKLLRYFAGFTRNVLVNSVRENETSNLLNNAPCMCGQFQNGFATNAAAKAELS
LDKQIRRLDQDVRRIGRISRRDLEEVLDEIRSHRTATSSQSLLVIRCCGNLVPEELPEVR
TALVQEIWKTLNALNVPMDISHYNALLRVYLENEHGFAPTDFLAEIEAKGIEPNRVTYQR
LIARYCQQGDIEGATRILEFMRAKSLPVNENVFNSLILGHSQANDLESAKGILGVMMQAG
LEPSADTYTTLLCAFARHGDLAAVKETLAECEQKEIILLDKDLLDIVYTLTVNGNGEHVD
DVLTKLRLSPGFNQDAVNVILRLVNKGHEDVGLKLLRVMPRSSRVNGEPVDVGAFFIRQM
VKANRPVEKILSICKSLQSEGLNPKALTIATEAGLTNGVINNALPLLQEMKNAGLPIRQH
YFWPLICSAESNQVLEIVRRMQQEFSVFPNSETVRDYVIPNLKEKNWERIVTSLRDAGVP
NSTAVTSAVYSALVTHQIAEAAKIMEKNRAYYVPFLFKQPLILALSHTNDYASFIRCVRQ
IHEGLQFRQGKDEEVEQVEGVAAVPTERITPDVVGAIVQEATTYFRRDRGATLEKILKGL
VKQGLSISSDKATQLSEQLGSELTPKISELLGKLSSGELEPVPLPNSGKRSLDSLSINEL
ERFIVNVEGKGENANNIKRQLLNACFRSQNLEKTLQVIEKLEAEKFQIPVGIYAQLIDLN
THHKKSSEALEIYGKLKAKDATFQLDNLKAVRLADLLLQEERVDAAFKILEENKKEVPVA
EAEGSYNYMSTVWRILNSLAEAGQPERLRKLFDVLVGANYIVPTNVLLGPLIKVHLVKDD
IPKAIEAFEEICQKYKSTPWKNELACRLIQKEDAANLQKLTDLSTGIHGEVNSLYDLVFS
FVECGRVRQARKILETPGLRTRPQRINSACDRYKNEGLLQPLEGLIEATKDLGHIDRNKI
YYTLLLSYDKADEAEKALGLWTKMQEENVTPNDAFLLKLAEILSKKNIDVPFVVPETQNE
QAKAKKSKAKDATTTEAATETAKVAEQPKEKAAKKEPAKTETAKPPKTASHLSGFRKAIQ
ANDPDAAISHKQSVLSGEKIGALDTSRLIELLVRADRLTEATKYVEELLGDKLHPQPKIF
KFYLNKIAAAGDLETMQRIGQQLNDEQKRLISFDNRFCHANIVAGKAEEFLKHLTTEIDA
AKTPEESTKLAEKFPRGGAVGILEKHPELVPQYQSLAEKFAAHNQLGPMNVLWMHLISTG
QEAASKEIWDKHLSNAPRLMFQRVLQTAREQQDEKLASTVISQLKNSKISEGAIGNAYSC
LIDIQTTKGNSDKAMVVLANAIKDVSLENINRTALLRLKQAVEEKSQKFPYTIPEKRTKA
DDSSSSSSSSSSDDDVSPSVPETVPPKPDSKA
Download sequence
Identical sequences Q9VJ86
FBpp0080637 7227.FBpp0080637 NP_523596.2.81976 FBpp0080637 FBpp0080637 FR380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]