SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080705 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080705
Domain Number 1 Region: 236-552
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.58e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000688
Further Details:      
 
Domain Number 2 Region: 103-222
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.97e-24
Family Anticodon-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080705   Gene: FBgn0086443   Transcript: FBtr0081162
Sequence length 558
Comment type=protein; loc=2L:complement(19130043..19131685,19131797..19131830); ID=FBpp0080705; name=Aats-asn-PA; parent=FBgn0086443,FBtr0081162; dbxref=FlyBase:FBpp0080705,FlyBase_Annotation_IDs:CG10687-PA,GB_protein:AAF53768.1,REFSEQ:NP_609948,GB_protein:AAF53768,FlyMine:FBpp0080705,modMine:FBpp0080705; MD5=434ad52959249b96b04943514caffc72; length=558; release=r5.30; species=Dmel;
Sequence
MPADQLAELTLGAIFTSEKKGSDESGDGSESKPFKTILQAMRHAGKEPFPTIYVDTKDPN
AAEPYEPAAKSQLKKIQKLFVRESHKNADKLQREAEDAEKRQQNLEDARKVKISEDPSLP
VARKIRIYEGTANRDSRVKVYGWVHRLRRQGKSLIFITLRDGTGFLQCVLNDQLCQTYDA
LTLSTESSVVLFGTLKLVPEGKTAPGGHELNVDYWELIGLAPPGGADAILNEEAQPDVQL
DNRHIMIRGENTSKVLKMRSVVTQAFRGHYEARGYNEVTPPTLVQTQVEGGSTLFKLKYF
GEEAYLTQSSQLYLETCLPALGDVFTISQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDL
LDRLEDLVCDVVDRVLKSPWGYLVKELNPDFKPPQKPFRRMNYEDAIKWLKENNVTKDDG
TFYEFGEDIPEAPERKMTDTINEPIMLCRFPAEIKSFYMQRCKEDQRLTESVDVLLPNVG
EIVGGSMRIYDSEELLKGYKREGIDPQPYYWYTDQRVYGTMPHGGYGLGLERFLCWLLNR
YHIREVCLYPRFLDRCRP
Download sequence
Identical sequences Q9V434
FBpp0080705 FBpp0080705 FBpp0304830 7227.FBpp0080705 FBpp0080705 NP_001260561.1.81976 NP_609948.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]