SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080884 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080884
Domain Number 1 Region: 708-789,982-989
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000023
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080884   Gene: FBgn0003475   Transcript: FBtr0081352
Sequence length 1020
Comment type=protein; loc=2L:join(20311820..20312414,20322010..20322080,20334081..20334198,20334621..20334730,20336287..20336404,20336464..20336549,20339245..20339375,20339582..20339693,20339980..20340112,20343599..20343672,20343743..20343947,20345173..20345259,20345525..20345670,20345906..20346244,20346308..20346511,20346578..20346891,20346950..20347169); ID=FBpp0080884; name=spir-PA; parent=FBgn0003475,FBtr0081352; dbxref=FlyBase:FBpp0080884,FlyBase_Annotation_IDs:CG10076-PA,GB_protein:AAF53884.2,REFSEQ:NP_724254,GB_protein:AAF53884,FlyMine:FBpp0080884,modMine:FBpp0080884; MD5=6b62128c9a6c1898f2c7a9ea43c78035; length=1020; release=r5.30; species=Dmel;
Sequence
MTEHQAEEQADTPPTKVKATPTPTPSGKFKDAKEDAFLSTSPDSANGDAQHKLPADQLAM
SSSAHPQQAGQARPLILQAFHRCSSPEQCVTLHDILDSFKAPLSEDQAWALIHQFAGLYH
QVAVQAHTCAADYEAALPTGFELHFHRDGSVHFSGPDQLTPKEQLQQEQIPLPPQHDVIV
DQPDHSASSSGDSSVINRAFDNSNHHHHHQHHHPPLVVSHRKIISELAEIVYTALDYNLP
EDEECQVSQELENLFNFMTADETDDDCIDEGIDEGDKRWDDESEEERNDTKELEHIIETC
RNHIKTTLPENHYRAVCRALVTETIELRVFLQQVLNNEAGAEKLIKASESSATTQQELAK
LGFNDWARFWVQVIDELRRGVRLKKSNHERTPIEYELTPYEILMGDIRAKKYQLRKVMVN
GDIPPRVKKDAHAMILEFIRSRPPLKKASDRQLGPPRMCEPSPREQLMESIRKGKELKQI
TPPEAPTLRERVLPSANSTLSRSRQRLIKVDFSKFQDDDLFYDENSISSSHSTAATHQHH
PHFAEMHRCSQPKMPPYPFGGYMVPSQARQDCRETASLMRPRRTMEPAKQVPPPEEPSFT
KDEYHKFYDTALESYDLATQCESRRASLRRHTIVGCQSNLDETHSMPPTRPESRQSDDVS
KETPKRSPAEQTHPSDEGSSTSSLGPWNKSFMDKQTWMERGDDRLSVTLAEIVHIRSVMT
KAELEGLPMDVRVKEDVEKRRVCFLCLRTRFSFFGPWGIQCKLCQRTVCAKCYTKMRIPS
EHFRNVPLVLISPSLLSSPASSSTPSPSHHAQQAHSSSTGNIMDDQFPKSLIERLLRSES
DRKTRSTVGSAPSSPKHQRSNMSTPGISVGPGASSSSAAATGQAVEALHDQATMSSSYSA
AMRPSGVHQQQKQHYNNAMSRSMEGPRSLPVHSPAYRPLSNNSTLERKSRFSRGFNLFSS
GSHLAQTQEQKENLRGEQVTVCNDCQGLVNEITSSVKQKRSSARNRTIQNLTLDLTPVWK
Download sequence
Identical sequences Q9U1K1
FBpp0080884 7227.FBpp0080884 FBpp0080884 FBpp0080884 NP_724254.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]