SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0080887 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0080887
Domain Number 1 Region: 313-394,587-601
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000508
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.025
Further Details:      
 
Weak hits

Sequence:  FBpp0080887
Domain Number - Region: 119-150
Classification Level Classification E-value
Superfamily PhtA domain-like 0.0876
Family PhtA domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0080887   Gene: FBgn0003475   Transcript: FBtr0081355
Sequence length 625
Comment type=protein; loc=2L:join(20342193..20342481,20343599..20343672,20343743..20343947,20345173..20345259,20345525..20345670,20345906..20346244,20346308..20346511,20346578..20346891,20346950..20347169); ID=FBpp0080887; name=spir-PC; parent=FBgn0003475,FBtr0081355; dbxref=FlyBase:FBpp0080887,FlyBase_Annotation_IDs:CG10076-PC,GB_protein:AAN11072.2,REFSEQ:NP_724256,GB_protein:AAN11072,FlyMine:FBpp0080887,modMine:FBpp0080887; MD5=5c25a5db08936a4f967786a4d67e240f; length=625; release=r5.30; species=Dmel;
Sequence
MEARPAKRSTAASVFRSHHMPRESDLVDIGSDASLYCGSDGESSQAQSTSTSTPNPQTSS
DQDLDQPQPTPRAAPRASASNNPPTPKPRQAIRSSKVLPSANSTLSRSRQRLIKVDFSKF
QDDDLFYDENSISSSHSTAATHQHHPHFAEMHRCSQPKMPPYPFGGYMVPSQARQDCRET
ASLMRPRRTMEPAKQVPPPEEPSFTKDEYHKFYDTALESYDLATQCESRRASLRRHTIVG
CQSNLDETHSMPPTRPESRQSDDVSKETPKRSPAEQTHPSDEGSSTSSLGPWNKSFMDKQ
TWMERGDDRLSVTLAEIVHIRSVMTKAELEGLPMDVRVKEDVEKRRVCFLCLRTRFSFFG
PWGIQCKLCQRTVCAKCYTKMRIPSEHFRNVPLVLISPSLLSSPASSSTPSPSHHAQQAH
SSSTGNIMDDQFPKSLIERLLRSESDRKTRSTVGSAPSSPKHQRSNMSTPGISVGPGASS
SSAAATGQAVEALHDQATMSSSYSAAMRPSGVHQQQKQHYNNAMSRSMEGPRSLPVHSPA
YRPLSNNSTLERKSRFSRGFNLFSSGSHLAQTQEQKENLRGEQVTVCNDCQGLVNEITSS
VKQKRSSARNRTIQNLTLDLTPVWK
Download sequence
Identical sequences B5RIQ1
NP_724256.2.81976 FBpp0080887 FBpp0080887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]