The results are sorted from lowest E-value to highest E-value. Strong classifications have a low E-value. Weak classifications have an E-value greater than 0.0001. Weak hits are shown in gray. Weak hits are not shown on the domain architecture.
The family level classification is conditional on the domain being a member of the specified superfamily. There is a possibility that the selected domain is a member of a sub-family for which no structure has yet been solved.
| Sequence: |
FBpp0080967 |
| Domain Number 1 |
Region: 27-144 |
| Classification Level |
Classification |
E-value |
| Superfamily |
Nucleic acid-binding proteins |
1.37e-24 |
| Family |
Single strand DNA-binding domain, SSB |
0.00076 |
| Further Details: |
|
| |
| Domain Number 2 |
Region: 181-245 |
| Classification Level |
Classification |
E-value |
| Superfamily |
"Winged helix" DNA-binding domain |
4.56e-16 |
| Family |
C-terminal domain of RPA32 |
0.0043 |
| Further Details: |
|
| |
The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by 
(show help)
Information Content (IC) is an information theoretic score measured in bits of how informative it is to assign a given ontological term to a domain archtecture. The higher the score the more informative it is to talk about the term given the domain architecture.
H-score (hypergeometric score) indicates the strength of assigning an ontological term to this domain architecture. Assignments with higher scores are of a better quality. Details for the methodology be found on the dcGO website.
| Cellular Component |
IC (bits) |
H-Score |
| Biological Process |
IC (bits) |
H-Score |
| Molecular Function |
IC (bits) |
H-Score |
| External link(s) |
Protein: FBpp0080967 Gene: FBgn0032906 Transcript: FBtr0081438 |
| Sequence length |
246 |
| Comment |
type=protein; loc=2L:complement(20925096..20925174,20925264..20925850,20925914..20925975,20926034..20926046); ID=FBpp0080967; name=RPA2-PA; parent=FBgn0032906,FBtr0081438; dbxref=FlyBase:FBpp0080967,FlyBase_Annotation_IDs:CG9273-PA,GB_protein:AAF53948.2,REFSEQ:NP_610077,GB_protein:AAF53948,FlyMine:FBpp0080967,modMine:FBpp0080967; MD5=d6972c7219a694bce853a942108ea26d; length=246; release=r5.30; species=Dmel; |
| Sequence |
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQYAMACVVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVNNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGSIADFTASQSSAIV
SGLEPKQQAVFQAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDAD
HFICTM
|
| Download sequence |
 |
| Identical sequences |
Q9VIH1
7227.FBpp0080967 FBpp0080967 FBpp0080967 NP_001260652.1.81976 NP_610077.1.81976 FBpp0080967 FBpp0305226 |
