SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081130 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081130
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000014
Family PHD domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081130   Gene: FBgn0261238   Transcript: FBtr0081613
Sequence length 1323
Comment type=protein; loc=3R:complement(2924033..2924205,2924277..2924454,2924548..2925244,2926859..2927219,2927321..2927819,2944680..2944770,2945184..2946604,2946664..2946860,2946997..2947351); ID=FBpp0081130; name=Alh-PD; parent=FBgn0261238,FBtr0081613; dbxref=FlyBase:FBpp0081130,FlyBase_Annotation_IDs:CG1070-PD,GB_protein:AAN13343.1,REFSEQ:NP_731132,GB_protein:AAN13343,FlyMine:FBpp0081130,modMine:FBpp0081130; MD5=4b7810603bdc7ff9ae2af256e199695b; length=1323; release=r5.30; species=Dmel;
Sequence
MKEMVGGCCVCSDERGWPENPLVYCDGQNCTVAVHQACYGIVTVPTGPWYCRKCESQERT
SRVRCELCPSRDGALKKTDNSGWAHVVCALYIPEVRFGNVTTMEPIILSLIPQERYSKTC
YICQEIGKPNRANVGACMQCNKSNCKQQFHVTCAQSLGLLCEEAGNYLDNVKYCGYCQHH
YSKLKKGGNVKTIPPYKPIQHDTSSDSCSSPEKEIDSTMNSATTSATIIKITSSSGSAGG
SSNVLNASSSAGISAGSSSGSGVSSSAKQRKSNASSKSSSSSSSSSSSSTGGAPNPSSSS
VHSGSASNMTGGGSVLPGSSNIGNISNSLNNNLPGGSSSTSSAGNVPGGSGGIISASSGG
ATQSTSSQSSTAPGTTKSSASSSSSSSNSYKEKHSKSLSKSTSSKDKDGKDSSTNSANNN
FTNSSASSTSSNSSSTREKSSSKLSKNKDSNQVPSATSSLSTTSSINTQPSSSTSTATAG
SGGTGTHVSSSAASGLNSAPSTTNEHSNHAHTLSTNGTGAGSAAGKLQSVSNLSNSSSGF
GSDLRSVSTSSSSTVNDSTGGFGSNSNSERENLSGAGSSASNMPGTIAPGTGGVSSSAAT
NLSTNKGGSSSSTANSLTSTSTSSGSSSNSSSKKRKADSAKSTSSISTSGSALEDNNSLI
SRYDIKDVQVALTPLTDFEKEIEKSSKRQRTELSPPTHQTSATAEVNAPLASSTSASIAV
TASATAASAPPATGTTTLGSSISGNAGSTSSGNSSGVSATGGAQSAVGSGGYPKTESSKS
SGTASAGSGSGSSSNTSSTKHGSNIKDISSSSNQQASTASSSSAPSLYVSVPLSTANVPG
INLPTSSTSSSTTSESHSASSRSSGAQSQHQQQLSNALVGPPMGGSAGAFHGGTTSAGSS
SVIQQQSGKSSPALGTLVSGNSGGSIISASGFPLPSGNLTATTTESGNLKISYEKQTTRV
QQLQEQEAPPARRSRTLDLSTASASSSSPSAVPATTSPLVVLSNQLPLNSVAASSSTGGL
KFTYESQTQMDVPMMPVSAIKDSPPSSPGSEIGSAMHSATTAPGSLTGASTAATAQPGNV
RKRGRKAKDATIAAAAAAAAAAAALSNSQQDLKDVRILQNGASNTPGNPAGSTPTPPATP
ASSNAVSSASSIITHTAAHMLGNQINPNSSVAQKLSEQLHMEVQDHSIYTPDSMNSQYAG
VPFPGKQRNSTAVPSNATPAQNPLQSMFSGGGMNGNMPIPQSLEQLLERQWEQGSQFLME
QAQHFDIASLLNCLHQLQSENLRLEEHVTSLIARRDHLLAVNARLQIPLSTIASNTKAEA
HGK
Download sequence
Identical sequences Q7KSZ0
FBpp0081130 NP_731132.1.81976 FBpp0081130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]