SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081219 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081219
Domain Number 1 Region: 214-283
Classification Level Classification E-value
Superfamily RING/U-box 2.4e-19
Family RING finger domain, C3HC4 0.0081
Further Details:      
 
Domain Number 2 Region: 89-152
Classification Level Classification E-value
Superfamily PA domain 0.000000641
Family PA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081219   Gene: FBgn0037442   Transcript: FBtr0081722
Sequence length 536
Comment type=protein; loc=3R:join(2210870..2210980,2211081..2211253,2211313..2211404,2211470..2211663,2211725..2211920,2212058..2212411,2212476..2212623,2212692..2213034); ID=FBpp0081219; name=CG10277-PC; parent=FBgn0037442,FBtr0081722; dbxref=FlyBase:FBpp0081219,FlyBase_Annotation_IDs:CG10277-PC,GB_protein:AAN13376.1,REFSEQ:NP_731080,GB_protein:AAN13376; MD5=d05a193140d66343a74f4a421c818118; length=536; release=r5.30; species=Dmel;
Sequence
MSKRSCQILTLLGLCLVCHEATLVGGHVLVYRKATSQLIEEFNDLPAQFGPNLPSNGLKV
YVVPARRPYYGCDSLDRPPHLKYPPSAKFVALVARGECVFERKIRVAQNASYSAVIVYNN
EGDDLEQMSAENITGIRIPSVFVGHTTGKALATYFTTEVVLIINDELPFNINTQLILPFS
ILIGMCFIIMVIYMIYKCIREQRRLRRHRLPKSMLKKLPVLRYTKNNANNKYDTCVICLE
DFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICKRKVFTKGEARASRSRQPSLDNVT
DTDDDTTPLLQQQQSNGRQVGQVSSASSAGGAAGSSSSVAAAAVAGTTRHGTFRRGHAGR
NPFEESQSSDDENALLASTVRPATSSGAHERINPFDRAPNLPAHLAEQLTESRRSVWSRI
NFASFFRRQPAVISVAAPPYLERVESGTSAMGLPVTGTIAVASPASNNILNPNLSGSFKD
EDDMPPHRSIYEPIAISTPAADSATVDDSAFLQTPTQGGIGVAALPHSASDRQFLI
Download sequence
Identical sequences Q9VI20
NP_001097695.1.81976 NP_649653.1.81976 NP_731079.1.81976 NP_731080.1.81976 7227.FBpp0081218 FBpp0081217 FBpp0081217 FBpp0081218 FBpp0081219 FBpp0112110 FBpp0081217 FBpp0081218 FBpp0081219 FBpp0112110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]