SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081308 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081308
Domain Number 1 Region: 64-300,497-579,647-761,879-1270,1321-1347
Classification Level Classification E-value
Superfamily ARM repeat 6.59e-72
Family Armadillo repeat 0.057
Further Details:      
 
Domain Number 2 Region: 1329-1607,1653-1724,1835-1872,1914-2124
Classification Level Classification E-value
Superfamily ARM repeat 4.03e-19
Family Armadillo repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081308   Gene: FBgn0037541   Transcript: FBtr0081818
Sequence length 2165
Comment type=protein; loc=3R:complement(3842402..3842727,3843930..3847671,3848179..3848211,3848340..3848613,3848675..3850315,3850375..3850791,3852499..3852563); ID=FBpp0081308; name=CG2747-PA; parent=FBgn0037541,FBtr0081818; dbxref=GB_protein:AAG22133.1,FlyBase:FBpp0081308,FlyBase_Annotation_IDs:CG2747-PA,GB_protein:AAG22133.2,REFSEQ:NP_649761,GB_protein:AAG22133,FlyMine:FBpp0081308,modMine:FBpp0081308; MD5=c2d4a569f36ec33bc50299495ec5edbf; length=2165; release=r5.30; species=Dmel;
Sequence
MENLNFARTPQFLRKVISEARRSFINSDHFSASSTRGRSETEEEAISEMELAHTLILNED
ALKQLPEHKRPVFELEWLRYLEKALPLVSKAEIKASQKKLVQQLSERIQGAPGPPIRKLI
ASALATLFSVGDTFMLFDTVNACNDILKNKDDSPSYLPTKLAAICVLGSMYEKLGRMMGR
TYEDTVQILIRTLRNAESQARIEIMHTLEKVSAGMGTAIANVHKDIYKAAKHCLLDRVMA
VRVAAARCILKMIYSAPFLYQTELESLGTLCFRAFDGSNYEVRCAVAQLLGTLLAYTQQL
AEAATSKKKQGQAVAIQAGKGATQRLVSLDEALGILMSGFLRGGASFLKGTGEIIKGSSG
VNREVRVGVTHAYVVFVQFMGSVWLERQLSTFLAHVLDLVANPKAACSHVDAVYSRKCIS
FILRSTIGKMLGEKAQSAACKELVHLVAKQMNSIDFNPENAKDSNQETLFSQHLLVCALQ
ELSSLLIGLGTTAQNLLGDQSLQAIDATCAVLVHPCAAARLAAAWCLRCACVAVPGQITP
LIDRFVEAIEQMRSSPEAMAGYSCALAAILGSVRYSPLGIPHTKGKVVFNCAEELLRSAS
QNSRMSLHRTQAGWLLIGAIMTLGSPVVKGLLPRMLLLWRNSFPRSNKELESEKARGDAF
TWQVTLEGRAGALSVMHSFLLNCPDLLNEDITRRLLTPIESALAMLVNLASVLKSYGTQL
KAPAAMVRLRLFETLTLLPANALEASYTHLLRMLVSEFTLSDNAANTTNSLLRTLCHGDD
SIILGTWLQETNHRTIEDQMEPNRKVDGEHLQPNSAAGSGALEHDPCCLYRPRSAQGNGS
SSNGSSATSTGGSNGGGGSNIQQISKAQQCPGPLPLGVAVIDMAVTLYGTIFPKVANKHR
LQMLEHFTECIRQAKSSRQEAVQMNIFTALLCALKNLTDSKTSLGQEDVRKSATALIVAS
LTSANSTIRCAAGEALGRLAQVVGDSHFTAELAQNSFDKLKSARDVVTRTGHSHALGCLH
RYVGGMGSSQHLSTSVSILLALGQDSASPVVQAWSLYALAQIADSGGPMFRGYVEATLTL
CLKLLLTVPHAHVDVHQCVGRVVNALITTVGPELQGGGGAVATMRGSFLCSAALLQSHSD
PLVQAEAIGCLQQLHLFASKSLQLEELVPTLVGMLACNYFILRKASVSCLRQLAHREAKE
VCELALTINAEQLPDLVITEYGLPGLLFSLLDTETDAEMLRNIHDTLTSMLQMLAADNLS
SWLSLCKNVLTVAVEGGLNDDPAAGEQSKSKEAGGEDDEEDEEEEYADDVTEYRAEENTS
THPAVQPRWPTRVFAAQCVRRIIASCEAASSVHFDLLQAKEQQLIRSRGDYLILHLAELI
RMSFMAATSDSDQLRLEGLRTLQEIIDRFANVPEPEFPGHLLLEQFQAQVGAALRPAFAP
DTPSHVTAAACEVCSAWIGSGVARDIGDLKRVHQLLVSSLDKLSSKTNSTQLYNESMATL
EKLSILKAWAEVYIVAMIGNGKAPASLLNLQSQQSGFQSLTNLETDSDVPDSRGESLLGL
VQPELHNLSTHWLSAMKDHALLLLPAEFQSQLPHDGGAFYTTDTINSSKPHYMTSWPPIL
YASALWLRDEGFARHLDTSEAAAESNNNQITHGSLSADRFHMIFGICMEALCSMRSSERP
RNIVSCLRSLHSIFDSDWARRQLVKDRALTIELCHVLHRQILTRDELLVQLLCVEILKQT
IRAAREDLERKRDDNANSEDGKGGERHGEDDSMQPGSSHVYAVLEVCLCLFVRQIPTMNP
TRQGAGGSGLQLDFAYAKMATGSSFFSVLGDENGLLVSSGLQCVEQLMDLCTPKGALAIL
PTVLYMTTSIVKEIANKSAIDSTILANTCAVKSALQCLRSVCVHKWAKVEETTEEWQQLL
QSALATIVDLTKTAGDNEERKVDEVTMLLAITVFILHTPASVVATPSLQYPCINHFRQCL
QSENLSVKLRCIETTRSIFARAELKTATPYIHALAPRIIESLYAESSKVPTSELELQVTL
ESIVTVEQLIDLSEPQNHIQMLTLLVPVLIGFLAEPSRLRTLPKYQRQLHDQALQWLLKI
GPKYPQEFKALMGQTPELRQKLEAAIRSQQQSINIAQKASEAQRNLLAKPQKPTIKLKTD
FSNFQ
Download sequence
Identical sequences Q9VHW9
FBpp0290139 FBpp0081308 NP_649761.2.81976 7227.FBpp0081308 FBpp0081308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]