SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081356 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081356
Domain Number 1 Region: 423-596
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.74e-54
Family Single strand DNA-binding domain, SSB 0.00000565
Further Details:      
 
Domain Number 2 Region: 284-404
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.42e-34
Family Single strand DNA-binding domain, SSB 0.0000849
Further Details:      
 
Domain Number 3 Region: 167-277
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.06e-33
Family Single strand DNA-binding domain, SSB 0.0000161
Further Details:      
 
Domain Number 4 Region: 4-117
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.71e-29
Family Single strand DNA-binding domain, SSB 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081356   Gene: FBgn0010173   Transcript: FBtr0081867
Sequence length 603
Comment type=protein; loc=3R:complement(4088084..4088395,4088475..4089693,4089751..4089995,4090057..4090092); ID=FBpp0081356; name=RpA-70-PA; parent=FBgn0010173,FBtr0081867; dbxref=FlyBase:FBpp0081356,FlyBase_Annotation_IDs:CG9633-PA,GB_protein:AAF54206.1,REFSEQ:NP_524274,GB_protein:AAF54206,FlyMine:FBpp0081356,modMine:FBpp0081356; MD5=4425d39514b971d001063620ad1e6d81; length=603; release=r5.30; species=Dmel;
Sequence
MVLASLSTGVIARIMHGEVVDAPVLQILAIKKINSAADSERYRILISDGKYFNSYAMLAS
QLNVMQHNGELEEFTIVQLDKYVTSLVGKDGAGKRVLIISELTVVNPGAEVKSKIGEPVT
YENAAKQDLAPKPAVTSNSKPIAKKEPSHNNNNNIVMNSSINSGMTHPISSLSPYQNKWV
IKARVTSKSGIRTWSNARGEGKLFSMDLMDESGEIRATAFKEQCDKFYDLIQVDSVYYIS
KCQLKPANKQYSSLNNAYEMTFSGETVVQLCEDTDDDPIPEIKYNLVPISDVSGMENKAA
VDTIGICKEVGELQSFVARTTNKEFKKRDITLVDMSNSAISLTLWGDDAVNFDGHVQPVI
LVKGTRINEFNGGKSLSLGGGSIMKINPDIPEAHKLRGWFDNGGGDSVANMVSARTGGGS
FSTEWMTLKDARARNLGSGDKPDYFQCKAVVHIVKQENAFYRACPQSDCNKKVVDEGNDQ
FRCEKCNALFPNFKYRLLINMSIGDWTSNRWVSSFNEVGEQLLGHTSQEVGEALENDPAK
AEQIFSALNFTSHIFKLRCKNEVYGDMTRNKLTVQSVAPINHKEYNKHLLKELQELTGIG
SSN
Download sequence
Identical sequences Q24492
7227.FBpp0081356 FBpp0081356 FBpp0081356 FBpp0081356 NP_524274.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]