SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081384 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081384
Domain Number 1 Region: 82-217
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.93e-35
Family Ribosomal protein L19 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081384   Gene: FBgn0037608   Transcript: FBtr0081901
Sequence length 306
Comment type=protein; loc=3R:join(4499909..4499972,4500025..4500881); ID=FBpp0081384; name=mRpL19-PA; parent=FBgn0037608,FBtr0081901; dbxref=FlyBase:FBpp0081384,FlyBase_Annotation_IDs:CG8039-PA,GB_protein:AAF54266.1,REFSEQ:NP_524284,GB_protein:AAF54266,FlyMine:FBpp0081384,modMine:FBpp0081384; MD5=36a0b7d08acfbf87f4121e86b0e7fda9; length=306; release=r5.30; species=Dmel;
Sequence
MNLSTRVMLNRLTQQCVYKRIVTFSTKTAEHVIENQEEQKKEAPPTTPTSPVNRKTIIPA
NYRFVYPEFLPDPKVEWRNLVREKLERLDMLDRRKQIDLPEFYVGSVLAVTSSDPHAAGK
TSRFVGICINRDRCGLRARFILRNVIDHQGMEVVYELYDPTILKIEVLRLEKRLDDSLFY
LRDALPEYSTFDENMEAEPLEEGAPVPVNDIKVVLRPRPWLERWERQNLRGVANIDEYLK
DKHRLSAAKVQKPWEKYDMMKDYRSSIPEEEQTEIFAEVHTELHALELQRKRNKRKRTFI
KPKQLA
Download sequence
Identical sequences Q9VHN6
FBpp0081384 7227.FBpp0081384 FBpp0081384 NP_524284.1.81976 FBpp0081384 FR152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]