SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081675 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081675
Domain Number 1 Region: 221-284
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000133
Family Eukaryotic type KH-domain (KH-domain type I) 0.00023
Further Details:      
 
Domain Number 2 Region: 287-370
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Weak hits

Sequence:  FBpp0081675
Domain Number - Region: 9-72
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0568
Family Cold shock DNA-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081675   Gene: FBgn0028734   Transcript: FBtr0082197
Sequence length 684
Comment type=protein; loc=3R:complement(5928954..5929324,5929395..5929469,5930011..5930518,5930601..5930732,5930782..5931091,5931156..5931223,5931281..5931446,5931512..5931835,5933152..5933201,5934417..5934467); ID=FBpp0081675; name=Fmr1-PA; parent=FBgn0028734,FBtr0082197; dbxref=FlyBase:FBpp0081675,FlyBase_Annotation_IDs:CG6203-PA,GB_protein:AAF54493.2,REFSEQ:NP_611645,GB_protein:AAF54493,FlyMine:FBpp0081675,modMine:FBpp0081675; MD5=8110c21cea11ff1e03c17c7aa623a62d; length=684; release=r5.30; species=Dmel;
Sequence
MEDLLVEVRLDNGAYYKGQVTAVADDGIFVDVDGVPESMKYPFVNVRLPPEETVEVAAPI
FEEGMEVEVFTRTNDRETCGWWVGIIKMRKAEIYAVAYIGFETSYTEICELGRLRAKNSN
PPITAKTFYQFTLPVPEELREEAQKDGIHKEFQRTIDAGVCNYSRDLDALIVISKFEHTQ
KRASMLKDMHFRNLSQKVMLLKRTEEAARQLETTKLMSRGNYVEEFRVRDDLMGLAIGSH
GSNIQAARTVDGVTNIELEEKSCTFKISGETEESVQRARAMLEYAEEFFQVPRELVGKVI
GKNGRIIQEIVDKSGVFRIKVSAIAGDDEQDQNIPRELAHVPFVFIGTVESIANAKVLLE
YHLSHLKEVEQLRQEKMEIDQQLRAIQESSMGSTQSFPVTRRSERGYSSDIESVRSMRGG
GGGQRGRVRGRGGGGPGGGNGLNQRYHNNRRDEDDYNSRGDHQRDQQRGYNDRGGGDNTG
SYRGGGGGAGGPGNNRRGGINRRPPRNDQQNGRDYQHHNHTTEEVRETREMSSVERADSN
SSYEGSSRRRRRQKNNNGPSNTNGAVANNNNKPQSAQQPQQQQPPAPGNKAALNAGDASK
QNSGNANAAGGASKPKDASRNGDKQQAGTQQQQPSQVQQQQAAQQQQPKPRRNKNRSNNH
TDQPSGQQQLAENVKKEGLVNGTS
Download sequence
Identical sequences Q9NFU0
FBpp0081675 FBpp0081675 7227.FBpp0081675 NP_611645.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]