SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081677 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081677
Domain Number 1 Region: 287-367
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000511
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 221-284
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000133
Family Eukaryotic type KH-domain (KH-domain type I) 0.00023
Further Details:      
 
Weak hits

Sequence:  FBpp0081677
Domain Number - Region: 9-72
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0535
Family Cold shock DNA-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081677   Gene: FBgn0028734   Transcript: FBtr0082199
Sequence length 681
Comment type=protein; loc=3R:complement(5928954..5929324,5929395..5929469,5930011..5930518,5930601..5930732,5930791..5931091,5931156..5931223,5931281..5931446,5931512..5931835,5933152..5933201,5934417..5934467); ID=FBpp0081677; name=Fmr1-PD; parent=FBgn0028734,FBtr0082199; dbxref=FlyBase:FBpp0081677,FlyBase_Annotation_IDs:CG6203-PD,GB_protein:AAN13452.1,REFSEQ:NP_731444,GB_protein:AAN13452; MD5=d0fc2f892ed7f7b7326e8a5571b598c2; length=681; release=r5.30; species=Dmel;
Sequence
MEDLLVEVRLDNGAYYKGQVTAVADDGIFVDVDGVPESMKYPFVNVRLPPEETVEVAAPI
FEEGMEVEVFTRTNDRETCGWWVGIIKMRKAEIYAVAYIGFETSYTEICELGRLRAKNSN
PPITAKTFYQFTLPVPEELREEAQKDGIHKEFQRTIDAGVCNYSRDLDALIVISKFEHTQ
KRASMLKDMHFRNLSQKVMLLKRTEEAARQLETTKLMSRGNYVEEFRVRDDLMGLAIGSH
GSNIQAARTVDGVTNIELEEKSCTFKISGETEESVQRARAMLEYAEEFFQVPRELVGKVI
GKNGRIIQEIVDKSGVFRIKIAGDDEQDQNIPRELAHVPFVFIGTVESIANAKVLLEYHL
SHLKEVEQLRQEKMEIDQQLRAIQESSMGSTQSFPVTRRSERGYSSDIESVRSMRGGGGG
QRGRVRGRGGGGPGGGNGLNQRYHNNRRDEDDYNSRGDHQRDQQRGYNDRGGGDNTGSYR
GGGGGAGGPGNNRRGGINRRPPRNDQQNGRDYQHHNHTTEEVRETREMSSVERADSNSSY
EGSSRRRRRQKNNNGPSNTNGAVANNNNKPQSAQQPQQQQPPAPGNKAALNAGDASKQNS
GNANAAGGASKPKDASRNGDKQQAGTQQQQPSQVQQQQAAQQQQPKPRRNKNRSNNHTDQ
PSGQQQLAENVKKEGLVNGTS
Download sequence
Identical sequences A0A126GUS7
FBpp0081676 FBpp0081677 FBpp0081676 FBpp0081677 NP_001303443.1.81976 NP_001303444.1.81976 NP_731443.1.81976 NP_731444.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]