SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081721 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081721
Domain Number 1 Region: 28-200
Classification Level Classification E-value
Superfamily TIMP-like 1.22e-36
Family Tissue inhibitor of metalloproteinases, TIMP 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081721   Gene: FBgn0025879   Transcript: FBtr0082244
Sequence length 210
Comment type=protein; loc=3R:complement(6030236..6030430,6030489..6030707,6030815..6030900,6030972..6031104); ID=FBpp0081721; name=Timp-PA; parent=FBgn0025879,FBtr0082244; dbxref=FlyBase:FBpp0081721,FlyBase_Annotation_IDs:CG6281-PA,GB_protein:AAF54507.1,REFSEQ:NP_524301,GB_protein:AAF54507,FlyMine:FBpp0081721,modMine:FBpp0081721; MD5=8ffb659f34e14ce3141bbdc9f2a77b48; length=210; release=r5.30; species=Dmel;
Sequence
MDLRKHLGLLTLLLVAVFAFYGRPADACSCMPSHPQTHFAQADYVVQLRVLRKSDTIEPG
RTTYKVHIKRTYKATSEARRMLRDGRLSTPQDDAMCGINLDLGKVYIVAGRMPTLNICSY
YKEYTRMTITERHGFSGGYAKATNCTVTPCFGERCFKGRNYADTCKWSPFGKCETNYSAC
MPHKVQTVNGVISRCRWRRTQLYRKCMSNP
Download sequence
Identical sequences Q9VH14
7227.FBpp0081722 NP_731461.1.81976 FBpp0081721 FBpp0081722 FBpp0081722 FBpp0081722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]