SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081862 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081862
Domain Number 1 Region: 15-295,326-864,900-1012
Classification Level Classification E-value
Superfamily ARM repeat 9.1e-111
Family Armadillo repeat 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081862   Gene: FBgn0037894   Transcript: FBtr0082386
Sequence length 1018
Comment type=protein; loc=3R:join(7238416..7238554,7238637..7239281,7239336..7239754,7239813..7240364,7240424..7241212,7241270..7241782); ID=FBpp0081862; name=Ranbp9-PA; parent=FBgn0037894,FBtr0082386; dbxref=FlyBase:FBpp0081862,FlyBase_Annotation_IDs:CG5252-PA,GB_protein:AAF54632.1,REFSEQ:NP_650068,GB_protein:AAF54632,FlyMine:FBpp0081862,modMine:FBpp0081862; MD5=59926746a270deedc65b23920bf824ba; length=1018; release=r5.30; species=Dmel;
Sequence
MSLQFQNDCGDSVKQAIIEELQNLLSSDTGVLQQTEKRIKQLEYTEGYGVYLSEIIMNQA
HELPLRQIAIVMLTRYVENHWTDDDDVKRKANGCMASEQAKRTIRNILPNGLYDPNSKIR
SSVAHTISTIAATDYPHCWAELFDIIVKCLGGNEDSIHGAMQVLQDFSYDVEQIKELGPV
VIPEVYRIFDSEQNYSIKTRVSAIRILKPLFASIAALITNKEEQSTMMSSILTNFMDKLM
HYLSMNSGAVSSFLLRTEIIKVFTHLVNEMPKYINPFMDRVLPIVWQLLTQIAETYVKVS
VNQTETSPLASGDSEEDDEQTNFQSLIIQILEFINCILTCNKLRGSIKNVLADLIYITIV
YIQLSEEQLEDWHDDPEKFVDDEDDGGVELTVRMCGRDVLLAINDEFGANAIQPLQEALG
RHFSVADAEKAANNPNWWKIQEACMDAVHAFRDVILAGDSTFDLLNYLTIVRNLLVHQES
PPLVGRALWTLSIYSKSDLYNPQMLTEILDVTLCSLSPEKSHILRISAVRTLNGFLQANE
TIDGEKRTLLVSKLPGFLDGIMALVPGSKAAVLALLMEALTFMVKFDAEFAFASQAKITP
LAIAVFLKYTEDPYVLETVQDLIKALCQRKECLGPLQEKFIPTIVSILGLTGAASTEKQD
IALDVLNTIVRYTEPPLNNSLLETAFPAIINCVLHTDDHAVMVAGGECLRSFINVSPEQI
CSYKNGEGINCIMQVVATVLLNPMNSEMTAAGQIGRLVITIITKMGSMLGQNVDMLLKAV
ISKMQNLECLKVIMNLVLIFAHLFLTQMDAVLNFLSTVPGPNGEPAMQFVLTNWLSRQNS
FFGNYERKVTTMALCKLFEYGVATQDNRLTTITFKELVDDPTDTRRRTRSVAATTQKWVT
IPALVKIFKVLISEYQHFQEGKSDEPLTDSEEDGDDEDAPGNPDKPRYISDLFESDEDNA
EDEQLLQELLKETNYQGDIADNLQKFLTTFTQNEHFPTFYEHLTEGERLILLSKVQQK
Download sequence
Identical sequences Q9VGP4
FBpp0081862 FBpp0081862 7227.FBpp0081862 FBpp0081862 NP_001287284.1.81976 NP_650068.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]