SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082030 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082030
Domain Number 1 Region: 253-434
Classification Level Classification E-value
Superfamily Kelch motif 5.62e-54
Family Kelch motif 0.00000883
Further Details:      
 
Domain Number 2 Region: 410-534
Classification Level Classification E-value
Superfamily Kelch motif 6.41e-38
Family Kelch motif 0.00022
Further Details:      
 
Domain Number 3 Region: 6-99
Classification Level Classification E-value
Superfamily POZ domain 4.29e-25
Family BTB/POZ domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082030   Gene: FBgn0037978   Transcript: FBtr0082557
Sequence length 538
Comment type=protein; loc=3R:complement(7834135..7834617,7834691..7834949,7835012..7835886); ID=FBpp0082030; name=KLHL18-PB; parent=FBgn0037978,FBtr0082557; dbxref=FlyBase:FBpp0082030,FlyBase_Annotation_IDs:CG3571-PB,GB_protein:AAF54738.1,REFSEQ:NP_731664,GB_protein:AAF54738,FlyMine:FBpp0082030,modMine:FBpp0082030; MD5=bb13e712b34fc0c9513cfe5e5dd1ea87; length=538; release=r5.30; species=Dmel;
Sequence
MPSQLLQVEDQTFSAHRVVLAATIPYFYAMFTNNMAESRIKEITMKESAIEPSALESLIN
YVYSGQVRIDNQNVQNLMVGASFLQLSNVRDACASFLISRFHPHNVLGIRTFADSMICRQ
LIDAADKYIDQNFAKVSQSEEFLALDCEQLLELMRRDELNVRTEEVIFEACMKWVKYAED
KRSELFPQVLAAVRLPLLSPQFLADRVAREELIRSSHQCRDLLDEAKDFHLMPERRGLLQ
SFRTRQRSGEFFTGQIYAVGGLASTGESVSTVEIYDPLTKKWKMGEQMSMMRSRVGVAVL
NGKLYAFGGFNGTERLSTVEVYDPRKNKWSQGCAMLCKRSAVGVAALDDCIYVCGGYDGV
TSLNTVEVYYPKSNTWKTVAQMMKYRSAGGVTQLNGYVYALGGHDGLSIFDSVERYDQAE
DVWVKMSPMLNRRCRLGVATLNGKIYVCGGYCGNSFLRSVECYDPQTDTWKLVTPMNCKR
SRVALAANMGKLWAIGGYDGESNLSTVEVYDPETDKWTFMPPMCAHSGGVGAGVIRIE
Download sequence
Identical sequences Q9VGE6
FBpp0082030 FBpp0082030 NP_731664.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]