SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082047 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082047
Domain Number 1 Region: 79-206
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.51e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0000312
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.92e-25
Family Glutathione S-transferase (GST), N-terminal domain 0.0000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082047   Gene: FBgn0010044   Transcript: FBtr0082575
Sequence length 212
Comment type=protein; loc=3R:8205758..8206396; ID=FBpp0082047; name=GstD8-PA; parent=FBgn0010044,FBtr0082575; dbxref=FlyBase:FBpp0082047,FlyBase_Annotation_IDs:CG4421-PA,GB_protein:AAF54793.1,REFSEQ:NP_524916,GB_protein:AAF54793,FlyMine:FBpp0082047,modMine:FBpp0082047; MD5=e5668ab3b0a85dcc4c4480e9406e3214; length=212; release=r5.30; species=Dmel;
Sequence
MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGF
SIWESRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNH
PADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVA
RWYENAKEVTPGWEENWDGVQLIKKLVQERNE
Download sequence
Identical sequences Q9VG92
FBpp0082047 FBpp0082047 FBpp0082047 7227.FBpp0082047 NP_524916.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]