SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082801 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0082801
Domain Number - Region: 221-255
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0125
Family Ribosomal proteins L24p and L21e 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082801   Gene: FBgn0038454   Transcript: FBtr0083356
Sequence length 543
Comment type=protein; loc=3R:complement(12470896..12471668,12471742..12472463,12472513..12472649); ID=FBpp0082801; name=CG10324-PA; parent=FBgn0038454,FBtr0083356; dbxref=FlyBase:FBpp0082801,FlyBase_Annotation_IDs:CG10324-PA,GB_protein:AAF55349.1,REFSEQ:NP_650571,GB_protein:AAF55349,FlyMine:FBpp0082801,modMine:FBpp0082801; MD5=289262e380ce15b8fb77060351de1d93; length=543; release=r5.30; species=Dmel;
Sequence
MEAKKISFGFSKLSKKPNILPSKQPKEESKVELIKCLEGNEIMPVDEKVEAAPLTIKMIG
MQKTSSALASLMRRRAVLLGEEEPDPEEVTPVAQSIAEVTAGGPTESLEQRAARELISAI
QNNGAEGLDDQKLVLPALSADELPLDGAKEATLDDYDNIPIQQFGLAMLRGMGWVDPPPK
KKGSGPIDDAPFLRPKGMGLGADKALKPKALLVQPEKNEVLEIKKQAYVRILGGKQKDQY
GQIQGFDDHAGRVIVKMAIGGAKEAFNEFLCQPVSRKEYSQYGKCINTAKYEEFKKNENE
HGQIIVKQENPSGRRDRDRREEIRSDRDEAQNQKSSKPGDQRSSKEDYRMKCKEEDKRSY
KYEDKKTYKDEHRRTYKDERKSYKEAKSNKEEVDREKKYVRSGSSSVSKREERERRRSPS
PRGRSPSKSKREDRDQKRSQSPRSTRRTKSSSDEADDTGESTESDSDSAYERRKHKKKSS
SHKSRKHSKKSKNKSRKADNDSSLESDDSLGENHRRHHSKHKKKTKRSKHVRSRTRSRSR
DRQ
Download sequence
Identical sequences Q9VES0
FBpp0082801 FBpp0082801 FBpp0082801 NP_650571.2.81976 7227.FBpp0082801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]