SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082864 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082864
Domain Number 1 Region: 334-615
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-81
Family Kelch motif 0.0000000284
Further Details:      
 
Domain Number 2 Region: 66-185
Classification Level Classification E-value
Superfamily POZ domain 4.71e-35
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082864   Gene: FBgn0038475   Transcript: FBtr0083423
Sequence length 776
Comment type=protein; loc=3R:complement(12900060..12900838,12900903..12901108,12901225..12901907,12901967..12902224,12902299..12902615,12903540..12903627); ID=FBpp0082864; name=Keap1-PB; parent=FBgn0038475,FBtr0083423; dbxref=GB_protein:AAN13732.1,FlyBase:FBpp0082864,FlyBase_Annotation_IDs:CG3962-PB,GB_protein:AAN13732.2,REFSEQ:NP_732202,GB_protein:AAN13732,FlyMine:FBpp0082864,modMine:FBpp0082864; MD5=8bca84456fd36f9299f17c8a06fece6a; length=776; release=r5.30; species=Dmel;
Sequence
MQTQMHSPMQYETHISDMPNHKGYPCRPEEAEMSNTSESCSISCGGRFGSAHSTLDDHDA
TDDDMTFCMSNYAKEALKMMYMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPYFKAMFT
GGLKESEMSRVQLQGVCPTAMSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACC
AFLERQLDPTNAIGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFLQLSAYQLIALI
RRDELNVQEEREVYNAVLKWVKYDEDNRHCKMEHILGAVRCQFLTPNFLKEQMKNCDVLR
KVPACREYLAKIFKDLTLHKCPGVKERTPNTTRMIFVAGGFFRHSLDILEAYNVDDMTWT
TLANLRIPRSGLGAAFLKGKFYAVGGRNNNIGSSYDSDWVDRYSAVTETWRPCAPMSVPR
HRVGVAVMDELMYAVGGSAGMEYHNTVEYYDPDLDRWTLVQPMHAKRLGVGVVVVNRLLY
AIGGFDGNERLASVECYHPENNEWSFLPPLQTGRSGAGVAAINQYIYVVGGFDGTRQLAT
VERYDTENDTWDMVAPIQIARSALSLTPLDEKLYAIGGFDGNNFLSIVEVYDPRTNTWTT
GTPLKSGRSGHASAVIYQPACSTTFMDYEDSDAPHPDGSNNGERNAHTPQNTYGSGSPHY
PGTASNMQFHTSYGMSGCNNCDSEMDIKPYIPAEHHSFQIPAIRSEELVNPNCPWSRMQE
RFRRTPPASFTDDERNANDMRHKLKKAQKECLFSTAAKVFHHHIEGRLRKLTSAAT
Download sequence
Identical sequences Q7KSF5
NP_732202.2.81976 7227.FBpp0082864 FBpp0082864 FBpp0082863 FBpp0082864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]