SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082865 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082865
Domain Number 1 Region: 302-583
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-81
Family Kelch motif 0.0000000284
Further Details:      
 
Domain Number 2 Region: 34-153
Classification Level Classification E-value
Superfamily POZ domain 4.32e-35
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082865   Gene: FBgn0038475   Transcript: FBtr0083424
Sequence length 744
Comment type=protein; loc=3R:complement(12900060..12900838,12900903..12901108,12901225..12901907,12901967..12902224,12902299..12902607); ID=FBpp0082865; name=Keap1-PC; parent=FBgn0038475,FBtr0083424; dbxref=GB_protein:AAO41571.1,FlyBase:FBpp0082865,FlyBase_Annotation_IDs:CG3962-PC,REFSEQ:NP_788685,GB_protein:AAO41571; MD5=3f2b09ffd6ce0e4b25f712acb624d91b; length=744; release=r5.30; species=Dmel;
Sequence
MSNTSESCSISCGGRFGSAHSTLDDHDATDDDMTFCMSNYAKEALKMMYMMRSHGMLTDV
VLEVKKELFPAHKVVLSAASPYFKAMFTGGLKESEMSRVQLQGVCPTAMSRILYFMYTGQ
IRVTEVTVCQLLPAATMFQVPNVIDACCAFLERQLDPTNAIGIAHFAEQHGCVELQKKAN
VFIERNFTQVCQEEEFLQLSAYQLIALIRRDELNVQEEREVYNAVLKWVKYDEDNRHCKM
EHILGAVRCQFLTPNFLKEQMKNCDVLRKVPACREYLAKIFKDLTLHKCPGVKERTPNTT
RMIFVAGGFFRHSLDILEAYNVDDMTWTTLANLRIPRSGLGAAFLKGKFYAVGGRNNNIG
SSYDSDWVDRYSAVTETWRPCAPMSVPRHRVGVAVMDELMYAVGGSAGMEYHNTVEYYDP
DLDRWTLVQPMHAKRLGVGVVVVNRLLYAIGGFDGNERLASVECYHPENNEWSFLPPLQT
GRSGAGVAAINQYIYVVGGFDGTRQLATVERYDTENDTWDMVAPIQIARSALSLTPLDEK
LYAIGGFDGNNFLSIVEVYDPRTNTWTTGTPLKSGRSGHASAVIYQPACSTTFMDYEDSD
APHPDGSNNGERNAHTPQNTYGSGSPHYPGTASNMQFHTSYGMSGCNNCDSEMDIKPYIP
AEHHSFQIPAIRSEELVNPNCPWSRMQERFRRTPPASFTDDERNANDMRHKLKKAQKECL
FSTAAKVFHHHIEGRLRKLTSAAT
Download sequence
Identical sequences Q9VEN5
FBpp0082863 FBpp0082865 NP_650594.1.81976 NP_788685.1.81976 FBpp0082863 FBpp0082865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]