SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083152 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083152
Domain Number 1 Region: 274-392
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000017
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083152   Gene: FBgn0038695   Transcript: FBtr0083738
Sequence length 555
Comment type=protein; loc=3R:join(15083428..15083823,15084032..15084446,15084520..15084674,15084735..15084843,15084900..15085123,15085178..15085295,15085354..15085604); ID=FBpp0083152; name=CG14280-PA; parent=FBgn0038695,FBtr0083738; dbxref=FlyBase:FBpp0083152,FlyBase_Annotation_IDs:CG14280-PA,GB_protein:AAF55656.1,REFSEQ:NP_650797,GB_protein:AAF55656,FlyMine:FBpp0083152,modMine:FBpp0083152; MD5=41eede677b2a047c2d8337b859a9ae11; length=555; release=r5.30; species=Dmel;
Sequence
MLSKRSDALISAFVLTLYYVGVADGNEASDFVTMGDLRRSRRIQTHFSRPGGMIMEGIGF
QYSMRYQPGFHLHKLAQQQADDGGMGGMENPPETEAPMPMPTPGTPPPEPAPTEPEEPEP
TIPMRPTTIPVEEPSPQPPTMMVPTPSASPGMQPSSKPRPTGKPSMSPPVPTIPSSTKSS
IMQPHQTLKNILFGSPIKANLILKKPNAPRSKGKGFLSLFEVIKFPNTKCSVSMGDIRSM
EGVCYHEFECKSLGGIPTESCAEGVGVCCVFVNGCGDVTSQQILYFESPNYPNAVREMMI
CVLIINVKKGVQQLRLDFQMFELSRPSNGDCVDDQFIVSGHNTNFQIPILCGINTGQHIY
IHVGDSNEGKVYLSVFMKVSGGGRSFNIKVTQVDDNLAPNNCLQYFHDAEGVIKSFNYDT
DGSIVDNREATYFNNLNYAICLARLKNVCSVAYNTEQLGGDQPDFQIINKDEAENDLISD
GQAGAGIFNCPDDFIAINSVPLCGERFNDGRESDDYTIHATVRDTAAGPIILPFRTDSEY
VGRGFRLLYKQELCA
Download sequence
Identical sequences Q9VDY3
FBpp0083152 NP_001287405.1.81976 NP_650797.1.81976 FBpp0083152 FBpp0083152 7227.FBpp0083152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]