SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083349 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083349
Domain Number 1 Region: 752-1078
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.53e-88
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000124
Further Details:      
 
Domain Number 2 Region: 532-722
Classification Level Classification E-value
Superfamily ARM repeat 6.24e-53
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.000046
Further Details:      
 
Domain Number 3 Region: 345-511
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.08e-44
Family PLC-like (P variant) 0.0057
Further Details:      
 
Domain Number 4 Region: 136-305
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.7e-35
Family Ras-binding domain, RBD 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083349   Gene: FBgn0015279   Transcript: FBtr0083941
Sequence length 1088
Comment type=protein; loc=3R:complement(16455469..16455597,16455661..16455780,16455849..16456019,16456079..16456385,16456442..16457029,16457231..16457437,16457500..16459244); ID=FBpp0083349; name=Pi3K92E-PB; parent=FBgn0015279,FBtr0083941; dbxref=FlyBase:FBpp0083349,FlyBase_Annotation_IDs:CG4141-PB,GB_protein:AAN14359.1,REFSEQ:NP_732536,GB_protein:AAN14359; MD5=3af9bc06a7c1bc81aaa07d01cd7141db; length=1088; release=r5.30; species=Dmel;
Sequence
MNMMDNRALAYVAHQPKYETPPEEAEPPCMRFSVNLWKNEMLNWVDLICLLPNGFLLELR
VNPANTIQVIKVEMVNQAKQMPLGYVIKEACEYQVYGISTFNIEPYTDETKRLSEVQPYF
GILSLGERTDTTSFSSDYELTKMVNGMIGTTFDHNRTHGSPEIDDFRLYMTQTCDNIELE
RSAYTWQQRLLYEHPLRLANSTKMPELIRERHPTRTFLIVVKNENDQSTFTLSVNEQDTP
FSLTESTLQKMNRSQMKMNDRTSDYILKVSGRDEYLLGDYPLIQFLYIQEMLSDSAVPNV
VLQSVYRLESYINHHNEQAMVTKRPLPKKRTVHLHKSISSLWDMGNYFQLTLHSISNVNF
DKTRALKVGVHVCLYHGDKKLCAQRSTDSPNGNFDTFLFNDLVMDFDIQMRNLPRMTRLC
IVIFEVTKMSRSKKSSNNKDIALKDVPYNKNPLAWVNTTIFDHKDILRTGRHTLYTWTYA
DDIQSVEVFHPLGTIEPNPRKEECALVDLTFLSSGTGTVRYPSEEVVLQYAADREQVNRL
QRQLAGPEKPIKELKELMANYTGLDKIYEMVDQDRNAIWERRNDILRELPEELSILLHCV
YWKERDDVADMWYLLKQWPLISIERSLELLDYAYPDPAVRRFAIRCLHFLKDEDLLLYLL
QLVQAIKHESYLESDLVVFLLERALRNQRIGHYFFWHLRSEMQTPSMQTRFGLLLEVYLK
GCKHHVAPLRKQLHVLEKLKQGSLIAKKGSKEKVKTMLQDFLRDQRNSAVFQNIQNPLNP
SFRCSGVTPDRCKVMDSKMRPLWVVFENADVNASDVHIIFKNGDDLRQDMLTLQMLRVMD
QLWKRDGMDFRMNIYNCISMEKSLGMIEVVRHAETIANIQKEKGMFSATSPFKKGSLLSW
LKEHNKPADKLNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILG
HFKEKLGVRRERVPFVLTHDFVYVINKGFNDRESKEFCHFQELCERAFLVLRKHGCLILS
LFSMMISTGLPELSSEKDLDYLRETLVLDYTEEKAREHFRAKFSEALANSWKTSLNWASH
NFSKNNKQ
Download sequence
Identical sequences P91634
7227.FBpp0083348 FBpp0083348 FBpp0083349 FBpp0083348 NP_001262770.1.81976 NP_650902.1.81976 NP_732536.1.81976 FBpp0083348 FBpp0083349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]