SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083613 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083613
Domain Number 1 Region: 981-1135
Classification Level Classification E-value
Superfamily alpha/beta knot 4.91e-31
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0029
Further Details:      
 
Weak hits

Sequence:  FBpp0083613
Domain Number - Region: 42-244
Classification Level Classification E-value
Superfamily ARM repeat 0.00173
Family PBS lyase HEAT-like repeat 0.06
Further Details:      
 
Domain Number - Region: 572-631,775-901
Classification Level Classification E-value
Superfamily ARM repeat 0.0122
Family Armadillo repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083613   Gene: FBgn0038953   Transcript: FBtr0084216
Sequence length 1136
Comment type=protein; loc=3R:join(18201757..18202926,18202983..18203632,18203691..18203876,18203939..18204502,18204566..18205087,18205156..18205326,18205388..18205535); ID=FBpp0083613; name=CG18596-PA; parent=FBgn0038953,FBtr0084216; dbxref=FlyBase:FBpp0083613,FlyBase_Annotation_IDs:CG18596-PA,GB_protein:AAF55981.2,REFSEQ:NP_651031,GB_protein:AAF55981,FlyMine:FBpp0083613,modMine:FBpp0083613; MD5=b0dfc6c422e8c593647ae721402a319c; length=1136; release=r5.30; species=Dmel;
Sequence
MSLPTTRATTATTTHAVVQAVETYIQNQNLLGEIAELDDMLYDLVSMHKDNELALKRVLQ
CIHNLLQTNSKYNVRFGPKVFHKLVSVVIADSREDSASRRQLVANLLVCVQLHIRKFPRI
EAKFVLQQLWSLSQSNERQPHAAQILVHLFDDFVNNLGTECAQELLVLTRNLLQSDVRDD
RRSAYFLMHKLQEIDEVLAALQCSEVQWSAYVGIMENLEEQQSHLVLPTLSTLLPRMGLM
SNNLSEDWLDWLRILCIRLLGDNNILVLRWTLKYFLSHFSLEQISRFNLLTQFLAATNRT
QLYNPEVPDCLTKQQITDFSAQFPAEILLEALVCVPWHAVPLIHWLQAWELKQLPVVSKE
LLFKLGARVRSLQNPVLRGEAINYVIFSLSATIDSLSLGDYLLFMESLYNTIDRYQSHSQ
LAQKIRNCSNLEKHIASFNIRCCELVSQMDYKHDVFVAFLEKLRTVPKSKHGWWRLLPIF
LHRELDHPEQYLDFYRSVYDLDTSFLESGVSLEQMQQHLLNRLDCQTREEKSFVLEHSVD
LFVQINLPTWSKLEVLNLNPLELLDRGTEETFATLSNILSTHDEQLADQNVLPAFISRLG
KLKVRETQAILKYAVQNLSSEEYEKCVVDVLEKNTFLLGTMDCEEYIKAPTSFVIKRMLQ
GETTTGDARIERAFEQISDTGAMDRVQFIQYAKNSTGLDISFICDDLLRMNNELSRKKPR
YFANCKEHRMKMRIGKALLDLSDRWKWSDNLWEAVLCPSDQPNISFMYEYLVSKMLPSID
LLLEQLKLLATLKPSQQISLVSVVHIYCLTRWESIQHEQLVEVFAVLLPLTMGANFQTRL
LAQLVLHRICSECEDRSIQMPIADALKKSIKVTLSEKLTEFQCEARLLLPELGKQCPTSV
SDCILMMTNAPFDENISFISCSYDFRMKLKRALETFKRKQSVLIPELATSLAALNGNVQR
KMNPVGDIYPESDFVVSNKARDDHELIVVASLIDKLPNLGGLARTCEVLGVNTLILGLKS
QAEKSDFTNLSMTAEKTLNILEVNPESLAGFLLEKQMEGYKIVGAEQTAHSTNFVDFKFP
KKSILLLGHEKHGIPANLIGFLDYAVEIPQYGLVRSLNVHVAGSLFIWEYCKQHLN
Download sequence
Identical sequences Q9VD22
FBpp0083613 FBpp0083613 7227.FBpp0083613 FBpp0083613 NP_651031.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]