SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083694 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083694
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000266
Family SAM (sterile alpha motif) domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083694   Gene: FBgn0039002   Transcript: FBtr0084301
Sequence length 142
Comment type=protein; loc=3R:18512626..18513054; ID=FBpp0083694; name=CG17625-PA; parent=FBgn0039002,FBtr0084301; dbxref=FlyBase:FBpp0083694,FlyBase_Annotation_IDs:CG17625-PA,GB_protein:AAF56040.1,REFSEQ:NP_651078,GB_protein:AAF56040,FlyMine:FBpp0083694,modMine:FBpp0083694; MD5=96fe6d07e7b3e9f8ca74b85b5a4936b2; length=142; release=r5.30; species=Dmel;
Sequence
MCGRAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPAHRKLLLEGVR
FLVNAPEQFICKEPCELHEEIELKLDPDVELFASLKCLENVDFLETPVPYSLTSPQKTLT
TRDSCKWNVKGVDQLPSDNIFN
Download sequence
Identical sequences Q9VCW5
NP_651078.1.81976 FBpp0083694 FBpp0083694 FBpp0083694 7227.FBpp0083694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]