SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083733 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0083733
Domain Number - Region: 78-106,142-156
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0154
Family Growth factor receptor domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083733   Gene: FBgn0039031   Transcript: FBtr0084340
Sequence length 159
Comment type=protein; loc=3R:18803030..18803509; ID=FBpp0083733; name=CG17244-PA; parent=FBgn0039031,FBtr0084340; dbxref=FlyBase:FBpp0083733,FlyBase_Annotation_IDs:CG17244-PA,GB_protein:AAF56073.1,REFSEQ:NP_651105,GB_protein:AAF56073,FlyMine:FBpp0083733,modMine:FBpp0083733; MD5=d769dcb79690b0ff6b37d598b66951b6; length=159; release=r5.30; species=Dmel;
Sequence
MKRFLVALLAALLVAAVQGGILGRIFHRESTSTTTSTTTTTTEEPRRPFYINNNIPEIPK
DCVAQFKCKKKLANVQAPKPCVKYCLHRITCPNNQTSPVQPNQCVDLDEQQVLAVHEANT
EPPVAGQTTTEKTMMVAMIDFPCQPGYLPDHRGRCREIW
Download sequence
Identical sequences Q9VCT2
FBpp0083733 7227.FBpp0083733 FBpp0083733 NP_001287477.1.81976 NP_651105.1.81976 FBpp0083733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]