SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084048 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084048
Domain Number 1 Region: 2010-2246,2285-2380
Classification Level Classification E-value
Superfamily Cysteine proteinases 1e-83
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000753
Further Details:      
 
Domain Number 2 Region: 1688-1979
Classification Level Classification E-value
Superfamily ARM repeat 0.0000257
Family Leucine-rich repeat variant 0.05
Further Details:      
 
Weak hits

Sequence:  FBpp0084048
Domain Number - Region: 2648-2858,2902-3072,3118-3137,3164-3279,3373-3431
Classification Level Classification E-value
Superfamily ARM repeat 0.000448
Family RPA1889-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084048   Gene: FBgn0039214   Transcript: FBtr0084668
Sequence length 3912
Comment type=protein; loc=3R:complement(20462180..20462919,20463020..20463357,20463426..20464395,20464463..20464815,20464877..20465063,20465142..20465317,20465381..20465486,20465546..20465945,20466172..20466354,20466421..20466691,20466753..20466940,20466999..20467122,20467184..20467836,20467895..20468081,20468135..20471407,20471467..20472353,20472415..20473324,20473401..20474112,20474230..20475267,20475366..20475408); ID=FBpp0084048; name=CG5794-PD; parent=FBgn0039214,FBtr0084668; dbxref=FlyBase:FBpp0084048,FlyBase_Annotation_IDs:CG5794-PD,GB_protein:AAF56319.2,FlyBase_Annotation_IDs:CG5794-PC,REFSEQ:NP_651275,GB_protein:AAF56319,FlyMine:FBpp0084048,modMine:FBpp0084048; MD5=0a63205a241f8607cacc49149430161f; length=3912; release=r5.30; species=Dmel;
Sequence
MCEVCADFQNLLELYEVRVASSDLKFQLLLKSEIETTFNYIQSWPQRQCMCLYRDTKNYD
RFNLVVQSLICLTVQHLKHIDHLIDNYKRLTASAAQVVAQAQQQREQQRDEASAQAEAKE
SSAPAEEPKKEEPSGSAGEEAQGSGDGPAKKPPVGPCTPPPPQTANPQHKSHLQYTEEPW
ILPEVEKLLVLVSKVFLLNFPLYIAHKHGMHSRLDDLQAEEAHHLALICDLHDNDLPIYL
LRNVSLFCNSGGFGAMSLCFEHPDLPVSTAHSMTAAVSNVKLWLNYHCNTQLFVPLRSRI
LQYMCKLSDQSLRSAATRAMADFVWSSMRDPLDVAVNFDTEGLALAFKYFTSTTLTMRLA
GMAQINAHINLFNEICTTETVNEVELFGQRIANWLTENHIVQHLFGPNLHVEIVKQAHVL
LNFLAVENQISEEDIKLIWQATQLKHCSKTIFDILPSLVKNLTPRPAMHLYSLLCRMDPK
EHTEQSIYIASALTKQLWTRDTSRSQMNLMQDHLLGSNVTASSSDSGSIEGSNTEDDHVG
ADDSSIASGGGGGGVGNKSPIDGVTPCKQARHRRHICDPTTEKGKQISPEDMAKVDLVNK
RIVNIIDNTSSEEELQSRAALELQLHRSRKKTSNKRRRQKTNKQIILPHELVEIWDGVED
VPSSDEADGEADGDGEGELLADSDECSDGATSQLVPDAVLKHLQGEGPFIRAIETNINEL
LSGAENDGSYSSPMSNKSEKNLADFDDEDVSPCEEELAQLVSSRANCSDVPPAFAAAAAA
MMVAQSAMALQKSGESNVAAAAAAVAAAAAATGTAQQTLVAMNRQASVAAAAAVVAAAKA
KSDSDVDLMDVVSGGKQHHSPKASQGSSTSGSTPVQPSFKLNDVCQPGNTLLWDLLQDDK
IGQLGESLALEAEKALATLLCFSMDRQLRTKFIEGCLYNVANNRSVIVSLRLLPKLFASF
QQFRPSDTHSMTMWAERNHRMMQCFFNNIRHYARRHAEVLITQNGEQQQQQLGGQLYSHK
TQVSVRLQFLSSIFSTVGSPKSFRLTLEQLDALWEWLAHDPECADCYFSWLQAQAKGGDQ
HALGIEALQHLYLKKLPELRPEEFSMVALGLFQQLCSFARIAMAEYDNHSDQISASASAV
GMYHLWKIALRAQSNDVSLAAIQYINMYYMGQQLRLEKEFVSQCMENLVQAATALESIDD
ENALMRVQRGLLLLNTHLDTFRRRYAFHLRRWAIEGKGIGSHSNLKNEGAGPPLRIVLQQ
AGLSEKSLLQMHACDLIADLKAEVSKWWESLQTGLAAPVLGLLLSDGPLRIITQGQELTS
DYDERSLGDAGFKDNQIVYVSLGGRGARRKESNLEHPSMLPPPPKECLPTVLLLQPKYFE
KLFCLMQTLGDMQPQASTVNPQHHTKAQLLSRRVWDILAMLPTNPHILDAFKSLVTDLSE
LEQLDAGGEEEQLATKRKQIKQKFRDLLDPNNLQKFMYSLHIVESLALTSSRRGESNGNV
AMGNTPEQVRVKKSSMGRRRNSNEQPPPPPPEVKMSKEQLCELEAPLTPTPSTGLQDVET
EASSSSGGDKENQPKQHSKRQKKGETFEQEKERPVGCSTPPSPTPPPPALSVVERGDNKW
SEAFVKCGGLRHLYEIFSEGQLQQSAHPKELALNEWRHDCLASLLRILWLLGFEELQSAD
AHVLMSRPHPFMLQLMEVPQCLTRLSSILNDEVHQQHQASSANPLVFPYQFQHLRTGFWG
RAQLIQFAMNILVSFVHASAEARRLLWAPTGTDHCRWLQKFILEDPEPAVRREICAGLYR
ICLGNAHSYRLLLAPLLHKLIALLPLAEQMSSGNQHTQFLLSEEGKDPYGPACRDYFWLL
ARLVDTLSPEMVAEEHIDIEMLCESISQSILTREYYELRHGYQDDGLVGLLNLMSNLIKY
DTTFKYTPKALSFIEQLIGFLFDMPSPADRQKPKCKSASSRASAYDLLVELCRGCATNYA
YLHGRLLAQHKSGPKQPYPWDYWPRDEGRAECGYVGLTNLGATCYMASCVQHLYMMPQAR
AAVLRVPPNAARKHGPTLLELQRMFAYLLESERKSYNPRSFCRVYQMDHQPLNTGEQKDM
AEFFIDLVSKLEDMTPDLKHLVKRLFCGSLSNNVVSLDCGHVSRTAEDFYTVRCQVADMR
NLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTML
KEKVNTHFSFPLRLNMCHYVEKTLMPQQYKEERERRQKEKEGADGSGDGNDNEKAEATLD
DDIEECYEYELVGVTVHTGTADGGHYYSFIKERTKTSYHTHERWFLFNDAEVKPFDPSQI
AAECFGGEMTSKTYDSVTEKYLDFSFEKTNSAYMLFYERRLPEHLQRRHSELLVTPTPSP
TVEEKSEAEEPTKMETSSSEIKADVDVEVEVEEKDKEKPAQTDTESKETPAKEEIADDKS
KQDEPEEKKIEKQSREGEEKSETDEKPTEMTTVSTEEEKQPTANCDNHQQNNNSNSKASN
DQQPSTSKAAQKLQLFRPLLNKELEDWIWQDNRQFLQDRNIFEHTYFNFMWQICGHIPQS
LISETDVTCMAAKLSVSFFIETFIHAKEKPTMVPWVELLTKQFNASQEACEWFLSHMSQE
PYWPVQVLIQCPNQMVRQMFQRLVIHVIQQLRASHAHLYLEVETDEDDKELIGQASCVTR
FIGSLISLLEHGARANLRHLSEYFGLLCEFSRMGDEEAMYLLRIGVLKSLVDFYLGHKQT
DSIDISSDNEDNSSEEALSVEKMRPASLDKMIALCASLVERSRGADFRLRLSPKDFSAIA
GGKGFPFLYQQIKDGINPHQTKHLIHALCRWDERLATQIIGMLFASVTKHTELCAPFFKL
LTLLTETQGGPVGLPCFTQLILPRMWDAAEYCPQSVLDWLSLQATKNKIAHAWILQSAEK
WLEQFLLAHDNTRVRNAAAFLLVALVPSQPFRANFRAHSQHKLLALNPHSYRDINSDAQA
VLHQVITLLLRLLRPARVYADIGAHGTTKLTAYFNLLSYCMVSKTEKLMASSYMRSLWEL
FHPRLSEPSVPAHHNKHALLTFWHHSLVDCPENAAQVANCPEITRNIAFNYILADHDDAE
IVTYNRSMLPAYYGLLRLCCEQSRALTRQLSQHQNLQWAFKNITPHPTQYAAAVDELFKL
MALFATRHPDASEQEKLDVTQFRRAVIVSYTSSLDARVSWSTLISALKILVDNEEDRTMV
IFNGGIEMCFEALHTLHSMHHEATACHVAGDLFDLLGEMLLLLATLRTRTDSPAQKKQQQ
QQQQLEQQLQLQQQQMLQKQQQQSQSQTQTPQSPQQKEKQLQQQMQQHLQLQQLQQMQFQ
QQHFLRQQHQHSALAKALPDAVKRLATLLNTFNSPEISRMALEVLKELVRNPSLETISIL
APILINCHLSVANAPNAIGPLGPYFPRRGAKHTPWPLGAKNSPRPPRPMVQMCIALAELT
PRGLDADYDVQVESFYRPYHDFIDVMMRMCVNTGTLNDTLVKLQCLVAIESTPLHFTYFP
KFWVGIHNNALTHKYVELLVKNQLLVEYLHNVLRDERSMLKDACVREFLELYYHKVAAQL
PVARMIYTINYGMHSKDDIDELCGDLFAIRIIAQATGVPASVRKELRGSLRALQNKSERF
RKESERDPFPNKKQKRDSQKIKEKEHPQPESEKETSTENDKPSDVSMESSGNAEQATDST
KPPTPAGSDDEQMDKTSVPSSDDETELEDELQPTPKRNKKASNKKTAQDRVNEEREKRLI
TLITMESYIQSIFAILKRDASVPSSGATKEPSEEPCGEASTSAAAAVKLSRPKGACTPPE
PITDVNDTRCNIDTETEAEADEQSPKTSQTNGSQQNESPPAATSADTAPANPSPAPAAAV
ASTSQAASPTQI
Download sequence
Identical sequences Q9VC56
FBpp0084048 7227.FBpp0084048 NP_651275.1.81976 FBpp0084048 FBpp0084048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]