SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084301 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084301
Domain Number 1 Region: 611-871
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-49
Family YWTD domain 0.000000995
Further Details:      
 
Domain Number 2 Region: 510-602,871-918
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.75e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 230-269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000995
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 4 Region: 434-475
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 311-350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 6 Region: 354-390
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 190-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 397-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 9 Region: 275-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 481-517
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084301   Gene: FBgn0051092   Transcript: FBtr0084927
Sequence length 1028
Comment type=protein; loc=3R:complement(21525707..21525748,21527031..21527177,21527247..21527383,21532009..21532207,21532538..21533935,21535013..21535239,21539259..21539378,21539564..21539683,21548138..21548278,21564777..21565332); ID=FBpp0084301; name=LpR2-PA; parent=FBgn0051092,FBtr0084927; dbxref=FlyBase:FBpp0084301,FlyBase_Annotation_IDs:CG31092-PA,GB_protein:AAF56498,GB_protein:AAF56498.3,REFSEQ:NP_733118,GB_protein:AAF56498,FlyMine:FBpp0084301,modMine:FBpp0084301; MD5=125285030dc6f362a1132e3d06188be3; length=1028; release=r5.30; species=Dmel;
Sequence
MATTCMPHFTEYFQTTTQSELTTNESANSRSSSSSSGCREPSKTSGFFYSASTHYQSKVQ
QLISFSFTSSFHLLFITCILSISKFCNAAAVNAAHVTAATPTASEIMHNLSGSALLERLK
ASTLGPTLDQLKHLAPAAANSISPGTGSGMGIGMGHFGSSINSVLNGNPLKFLNVSGKIG
TPLDISLGLSNYCDEKQFQCSTGECIPIRFVCDGSSDCPDHSDERLEECKFTESTCSQEQ
FRCGNGKCIPRRWVCDRENDCADGSDESTSQCRGLCSSLMFMCKNGEQCIHREFMCDGDQ
DCRDGSDELECGNRTCRSDEFTCGNGRCIQNRFKCDDDDDCGDGSDEKNCGEKAKCGSNF
FACKSGPCIPNQWVCDGDSDCRNGEDEMQNCTVSLLNFCQAGEFQCSDRITCLHKSWVCD
GEADCPDGEDESQSNCLKVSCRPDQFQCNDQSCIAGHLTCNGKRDCADGSDEIMCDISAT
PRTCNATTEFDCGGGLCIPNAKVCNRRKDCPNGEDEPAGKCGINECSSKNGGCMHQCVNL
EVGYRCECHDGYKLGADQHTCVDIDECETPGICSQVCVNEIGAFKCECEAGYMRLLKNHT
RCKASEGHASLLLARRHDIRKIALDRPEMTSIVNSTKAATALDFVFRTGMIFWSDVATQS
IYKAPIDEGNDRTVVLTKSSVTSDGLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVK
DSLDIPRSIALDPIEGWMYWSDWGASPRIERAGMDGTHRTAIITYDVKWPNGITLDLVQK
RLYWVDGKLNTISSSNYDGSQRHQVLYSGEYLRHPFSITTFEDYVYWTDWDKQAVFKANK
FNGMDVEPVTATHMLEHPMVVHVYHPYRQPDGVNHCQSVNGHCSHLCLPAPRINERSPRI
SCACPTGLKLMPDGLMCVEDLETKTGNNRTDTSNQVHKSDAESENDYVEIALHVIASLAG
TALVASVIYVVYRRCTRAVNSMNFENPVYHKTTEDHFSLEKNGTPHIYAAANDEEAVNPL
FKSGTECV
Download sequence
Identical sequences Q9VBN2
FBpp0084301 NP_733118.3.81976 FBpp0084301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]