SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084420 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084420
Domain Number 1 Region: 149-489
Classification Level Classification E-value
Superfamily Subtilisin-like 1.44e-82
Family Subtilases 0.00000000633
Further Details:      
 
Domain Number 2 Region: 483-629
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.36e-41
Family Proprotein convertase P-domain 0.00014
Further Details:      
 
Domain Number 3 Region: 40-114
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 7.31e-16
Family Prohormone convertase 1 pro-domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084420   Gene: FBgn0023179   Transcript: FBtr0085048
Sequence length 654
Comment type=protein; loc=3R:complement(22525009..22525170,22525225..22525342,22525437..22525601,22525670..22525903,22526149..22526462,22526534..22526709,22527238..22527326,22527670..22527746,22528196..22528233,22528324..22528594,22529437..22529544,22539233..22539445); ID=FBpp0084420; name=amon-PA; parent=FBgn0023179,FBtr0085048; dbxref=FlyBase:FBpp0084420,FlyBase_Annotation_IDs:CG6438-PA,GB_protein:AAF56615.1,REFSEQ:NP_477318,GB_protein:AAF56615,FlyMine:FBpp0084420,modMine:FBpp0084420; MD5=0579ab6dbc37648e03b76fd29dec32e1; length=654; release=r5.30; species=Dmel;
Sequence
MAAATWSWLLAPFLLLHWASAGAGGGAGGSGAGLSGPAVFTSSFLVRFRRGVDNSFAHDV
ADKYGFDNLGPLVGADGHEYHFKHRTLPHARSRRSLTHTRALKSHPAVHTAVQQPGFKRV
KRGLRPAVPAIHGMKFDLKVGEGNRIDEEPTDPYFPMQWYLKNTGQNGGKVRLDLNVQAA
WAQGITGKNVTTAIMDDGVDYMHPDLKFNYNAEASYDFSSNDPFPYPRYTDDWFNSHGTR
CAGEVAAARDNGICGVGVAYDSKIAGIRMLDQPYMTDLIEANSMGHEPHKIHIYSASWGP
TDDGKTVDGPRNATMRAIVQGVNEGRNGLGNIYVWASGDGGEEDDCNCDGYAASMWTISI
NSAINDGQNAHYDESCSSTLASTFSNGAKDPNTGVATTDLYGKCTTTHSGTSAAAPEAAG
VFALALEANPQLTWRDIQHLTVLTSKRNSLFDAKNRFHWTMNGVGLEFNHLFGFGVLDAG
AMVTLSKQWHSVPPRYHCEAGELTQPQAIVMGRSLFWEIKTDACKGTDTEVNYLEHVQAV
ISANASRRGDLELFLTSPMGTKSMILSRRANDDDHRDGFTKWPFMTTHSWGEYPQGTWKL
EARFNSPQTRHGNLLEWSLVLHGTKEAPYRTLHPSSPHSKLAIVKKAHEDKKMK
Download sequence
Identical sequences Q9VBC7
FBpp0084420 FBpp0084420 FBpp0084420 7227.FBpp0084420 NP_477318.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]