SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084437 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084437
Domain Number 1 Region: 90-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000644
Family Growth factor receptor domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084437   Gene: FBgn0004359   Transcript: FBtr0085065
Sequence length 419
Comment type=protein; loc=3R:join(22709678..22709945,22735198..22736189); ID=FBpp0084437; name=T48-PA; parent=FBgn0004359,FBtr0085065; dbxref=FlyBase:FBpp0084437,FlyBase_Annotation_IDs:CG5507-PA,GB_protein:AAF56637.1,REFSEQ:NP_524522,GB_protein:AAF56637,FlyMine:FBpp0084437,modMine:FBpp0084437; MD5=2d9ee5db8c0a9cdd252a38e052a895cc; length=419; release=r5.30; species=Dmel;
Sequence
MRSVEVAQSGPSAIFWLVQVLIVGAAQAATPFAKEYRNAGLYNGNTLVDLDGSTTLDMGQ
EKPTSSSSGLSGGFKSESSVVLPGMLQNSGCPLTTSSHCLRCNKVGCIKCPMYLVTDTRQ
CVDQCPAGYLDQWSAHTEFMGRVCVPTGYSGPLMAALAGLLGGFLVCLSLLAVAVMLVKR
KRRRKSIKQKLINENTMDRADFMRQLNEMRPNAEYFLAMLNDTRRQIRKLYLSGEVAAAN
SYRPIVRDLAKLLILLNRPIELIPAPPPDWSRLYAWSEQALERYKPQVGQLIDFFQASHG
HSAGHHEVLYAAPNKKKQLQQPSIFRQQVTPTATPQGVGELMAGDRSSSASAQQKLHLFG
SLISLHEFEEPRASDPFGSSFNTLKSGNLISDLNASSLWLEDEFYKLGFRPQDEITTEL
Download sequence
Identical sequences Q9VBA5
FBpp0084437 FBpp0084437 NP_001262999.1.81976 NP_524522.2.81976 FBpp0084437 7227.FBpp0084437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]