SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084495 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084495
Domain Number 1 Region: 133-297
Classification Level Classification E-value
Superfamily RUN domain-like 8.89e-45
Family RUN domain 0.0000018
Further Details:      
 
Domain Number 2 Region: 664-727
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.72e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084495   Gene: FBgn0051064   Transcript: FBtr0085125
Sequence length 729
Comment type=protein; loc=3R:complement(23055539..23056166,23056290..23056387,23058195..23058597,23058657..23058907,23058970..23059403,23064247..23064622); ID=FBpp0084495; name=CG31064-PB; parent=FBgn0051064,FBtr0085125; dbxref=FlyBase:FBpp0084495,FlyBase_Annotation_IDs:CG31064-PB,GB_protein:AAN14401.1,REFSEQ:NP_733203,GB_protein:AAN14401,FlyMine:FBpp0084495,modMine:FBpp0084495; MD5=ed31ec18c7656a9031cbbcd220c7fbcb; length=729; release=r5.30; species=Dmel;
Sequence
MSTDDLLVRRERSEDSQSSSVSIPVTPTTGGAAPAPSAPTSSLDRLRNTFRRTESISSQI
FSHISTQFSNAAAAAASSEVIDGTTTYPYPDEPAPPVVPVAPDTVASASASSPSPSKLKA
KRLKRARDTAEIERSNLVNICKLVVKELLEQSLRYGRMLDSDHLPLQHFFIVIEHVLGHG
LRPKKGLLGPRKELWDLLQSVEHYCPEAQDITASVRDLPTVRTHIGRARAWLRIALMQKK
LSDYLQALIEHREDSLFDYYEPHALMMSDEIVVIMGILVGLNVIDCNLCVKEEDLDSQQG
VIDFSLYLRSSSRNADAAPEDSAPPALLDATGQGNMIAVLDQKNYIEELNRHLNATVGNL
QAKVESLTTTNALMKEDLAIARNSLLALQAENQAMRQSTSAGDNNSTGSGGSSDKDKEKA
SEELVEERRKNSELEKELKLQVSLKAESDMAMKLLEKDIHEKQDTIVSLRRQLDDIKQIN
LEMYRKLQDCKASLTHKTELMTKLEVQKEDMASTIDQLEKKWSHDKSNLGEILKTTSQTL
TTQVTASEERAARAEAESRIEREWRISLQEKELKLKEKIANLQGCLKELSEEKERNGKLK
ADLDKVRTQWSEAQTTLEELGIQLSVSKLKVSEMQDQERRQRQLLSGSAQSLQAMPEAVG
SPGIWAPDSIATHCTACEREFNLTRRKHHCRSCGEIFCKACSEHTLPLLNAQGQPGKPVR
VCDNCYAAK
Download sequence
Identical sequences Q8IMP2
FBpp0084495 FBpp0084495 NP_733203.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]