SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084562 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084562
Domain Number 1 Region: 6-180
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.04e-56
Family G proteins 0.00000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084562   Gene: FBgn0039532   Transcript: FBtr0085192
Sequence length 195
Comment type=protein; loc=3R:join(23463610..23463725,23463795..23464027,23464101..23464261,23464345..23464422); ID=FBpp0084562; name=Mtl-PB; parent=FBgn0039532,FBtr0085192; dbxref=FlyBase:FBpp0084562,FlyBase_Annotation_IDs:CG5588-PB,GB_protein:AAF56727.1,REFSEQ:NP_524533,GB_protein:AAF56727; MD5=505046768506acf1d253125e2f170c31; length=195; release=r5.30; species=Dmel;
Sequence
MSTGRPIKCVVVGDGTVGKTCMLISYTTDCFPGEYVPTVFDNYSAPMQVDTIQVSLGLWD
TAGQEDYDRLRPLSYPQTDVFLICYSVASPSSFENVTSKWYPEIKHHCPDAPIILVGTKI
DLREDRETLSGLAEQGLTPLKREQGQKLANKIRAVKYMECSALTQRGLKPVFEEAVRAVL
RPEPLKRRQRKCLIM
Download sequence
Identical sequences B4IGU2 Q7JWS8
FBpp0084561 FBpp0084561 FBpp0084562 FBpp0084563 FBpp0291747 FBpp0084561 FBpp0084562 FBpp0084563 FBpp0291747 NP_524533.1.81976 NP_733222.1.81976 NP_733223.1.81976 XP_002042952.1.34323 XP_002045789.1.34323 XP_016036604.1.80810 FBpp0192955 FBpp0197823 7227.FBpp0084562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]