SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084720 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084720
Domain Number 1 Region: 259-650
Classification Level Classification E-value
Superfamily ARM repeat 4.68e-41
Family Armadillo repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084720   Gene: FBgn0015589   Transcript: FBtr0085351
Sequence length 2417
Comment type=protein; loc=3R:complement(24658957..24662208,24662269..24662407,24662621..24666483); ID=FBpp0084720; name=Apc-PA; parent=FBgn0015589,FBtr0085351; dbxref=FlyBase:FBpp0084720,FlyBase_Annotation_IDs:CG1451-PA,GB_protein:AAF56820.1,REFSEQ:NP_477152,GB_protein:AAF56820,FlyMine:FBpp0084720,modMine:FBpp0084720; MD5=2047cf85a167b358eb71ec5c195b443a; length=2417; release=r5.30; species=Dmel;
Sequence
MLEPTLTPDLEEGIAELSLEDVDVDSVPERKPHFLDYDAVPPPDYEEGFGASSGEQLKMD
KKYERDGEVSDYELAASGYTKKEFTQDDNTLHFTQSAVGLGSGAVGKKPAAKHFLDENPI
PPDYMLAQELREMREHRSLDRNFERQSAQQQQLDELPPRNGGGSPASAGRPSRSKEPSYT
LSRFLDGDAPAPAPRLPKGAAWTTSFDERYTSSAVEATLGSKVECVYSLLSMLGSNDPLE
MAKKFLELSGNAQSCATLRRSGCMPLLVQMMHAPDNDQEVRKCAGQALHNVVHSHPDEKA
GRREAKVLRLLDQIVDYCSFLKTLLQSGGEAIADDSDRHPLAAISSLMKVSFDEEHRHAM
CELGALHAIPNLVHLDHAVHGPKPEDQCCNSLRRYALMALTNLTFGDENNKALLCGQKQF
MEALVAQLDSAPDDLLQVTASVLRNLSWRADSNMKAVLNEIGTVTALALAAMRNRSENTL
KAILSALWNLSAHCSTNKAEFCAVDGALAFLVGMLSYEGPSKTLKIIENAGGILRNVSSH
IAVCEPYRQILRQHNCLAILLQQLKSESLTVVSNSCGTLWNLSARSAEDQKFLWDNGAVP
MLRSLIHSKHAMISEGSSSALKNLLNFRPAVQNHHQLDPIARSMGLKALPTLEARKAKAL
QQELGERHTAETCDNLDTGGKLDKERASSSSRRHPAPRLTRSAMLTKSESRDSVYSAKSD
CAYDHLIRSASASDAHRKVKPKITDFDLEMEQDTEATEEQPIDYSVKYSENATKTSTYQE
TDLDQPTDFSLRYAENQIESDLDISGPAGGQKSTITPPAETVPEKSEGQEILLILDDSVK
CYQTEDTPYVISNAASVTDLRVAAKADAEAEVKPEVREVTSKEGAPKKLPKLSQCGSGSY
TPEKPINYCEEGTPGYFSRYDSLSSLDESGKANQAIVGTDADIKPKLEKQEEQESQPAEQ
VLTKPPTQANSALETPLMFSRRSSMDSLVHDPDVDVANCDDKSSVVSDFSRLASGVISPS
EIPDSPTQSMPQSPRRNSVAGSGQNVDSPPVVIPASLQPLRSVFEDDLSSFNVEHTPAQF
STATSLSNLSIVDDEKAPASVAEEDNEDELLLANCINMGMQRKPTEAVKSTVVNSEVDVA
EETIRSYCTEDTPALLSKVPSNTNLSVISMSSTDPKDATAGQAQMYAHQLSDDVSSNASD
CGGASGHLLQQCIRDGMKKPLGEATSDPIAMLRRGGNELPGYLPSADEMNKFLVEDSPCN
FSVVSGLSNLTVGSSLVGPAVQLKETEPSSADQNPEMKAKPGKQEQVRRPPHWQDDSLSS
LSIDSEDDTNLLSQAIAAGCNRPKSNLGFSSNGKRSSSLSSSQPIAINAATSASSLNSAM
TVRKSQQQESYSSVDSSDSNDNQSKSLFELCILKGMYKTKEPGARAQQMQEQPIVGSSSV
QSNPSLKQFDSLPVQLPSSGQVKRQRHHHHHHHHRERERERKDEKLLQECINTGISKKIN
AVPKNVLATSAAALEPCHPMAATTSASALSTAAPDVEQKAHATSNPQQQSSTHPSSHILP
NPIDAIATVTDTVRSPAAPNQGNGNASQNGLETATGSKDLDSEDRSSDESNQSFIMETMV
RLDSALNETCISGASEKHKDPDLMLKSVERLTMEFVTSAEQLRSSSHNHSSSNSHKNNSS
NNTWNESTCPNDVSFPSVSQTAPVLASLSLDEDATEARSLHELIEITPTNEQQPESLEGE
TDTLVNGHADSYSGSSGGLNFQLGGQVQNAGVRLEPQRLLFNGTSASIMTNSTMIAFEAR
ALAENLLQPAATDDDTTEMTFSLNSLDLDNIRPPSGMESLNSCYQDHSQPSSLRQAMPSK
SPRFARKMFPANLVARRALGHLAGSAESVNSSCNLLDNIKPPSLMDELLDSMISVDSIQS
EVADGEQDCSMATTISVSNYETAACDDQTMTVLQSCFDEDEDATMNDYSSAESTPKHGST
PSPNRRSLTPKDKRRLTKDRFKTYTIATSCEMEAPEANETLQIEIVEAAVPVATPSPRAN
GRRRGSAERYKTQLIECPLALIQPQPDDCPSEQLSSIRAMMQQFTFITDINIGHSQETCE
STDHPEDAGESPECDQNSETESCDGQEPDQLPPPPSIVDLRTSVVKPTTLEPATAVKLVR
GRKKPAYVSPYSMQSQRNSNNAAPSKKKTLSPTIAKRSLVPGGSGVRLPAKKKPTPPPEP
APARLERQGTFVKDEPTNSNVQVPVVETKPAQTSPTHRASKLPTKKGTASGGSPSKAGSP
KRIPLAPARRMTPQRANTSLRLAAGKSHAASRVVSGRVSSTTPPSRSNSNLNGSSAAAAA
AAKINHAQSRIANIWKRVDEAKTKQSSSNLRTQKTKSSNMLNANGTKPTLLRSSTFDNTP
STAGGVKSKLPVVGARK
Download sequence
Identical sequences Q9VAS9
7227.FBpp0084720 NP_001263046.1.81976 NP_477152.1.81976 FBpp0084720 FBpp0084720 FBpp0084720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]