SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084839 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084839
Domain Number 1 Region: 89-271
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4e-38
Family CBM11 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084839   Gene: FBgn0039689   Transcript: FBtr0085473
Sequence length 296
Comment type=protein; loc=3R:join(25562766..25563239,25563298..25563714); ID=FBpp0084839; name=CG7598-PA; parent=FBgn0039689,FBtr0085473; dbxref=FlyBase:FBpp0084839,FlyBase_Annotation_IDs:CG7598-PA,GB_protein:AAF56928.1,REFSEQ:NP_651718,GB_protein:AAF56928,FlyMine:FBpp0084839,modMine:FBpp0084839; MD5=8eef07912178f906a1236e3b3175523c; length=296; release=r5.30; species=Dmel;
Sequence
MNSLLRQGLRLGCCLPAVQQQIHTTAVHRTFWEREKKSGYKTKLPEPSKKQMIMDGLRDL
KEEMKLWRQEVKEQFESDPILVFRPGETDVVFDFKAPDVLDKWTVTTDADHGEGKSTATL
ELSAAGAGLFHGQVNSDHTKDGIIKRTGYANIRTKRVRKSFKRETTYDWTQYNMLVMKVR
GDGRSYLINLHTEGYFDLMWNDIYHYVLYTRGGPHWQIAKIPFSKFFLSSKGRVQDRQGA
IPLNRVTHFGFSVAAKKGMDGPFGLEIDYVGLEYDPSHREEFAYEMYQTPKYIVAT
Download sequence
Identical sequences Q9VAI1
FBpp0084839 7227.FBpp0084839 NP_651718.1.81976 FBpp0084839 FBpp0084839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]