SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085033 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085033
Domain Number 1 Region: 175-260
Classification Level Classification E-value
Superfamily TPR-like 0.00000359
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085033   Gene: FBgn0051013   Transcript: FBtr0085671
Sequence length 534
Comment type=protein; loc=3R:complement(26469603..26469688,26469757..26469922,26469981..26470115,26470174..26470700,26470752..26470945,26471007..26471309,26471362..26471555); ID=FBpp0085033; name=CG31013-PA; parent=FBgn0051013,FBtr0085671; dbxref=FlyBase:FBpp0085033,FlyBase_Annotation_IDs:CG31013-PA,GB_protein:AAF57073.2,GB_protein:AAF57073,REFSEQ:NP_733394,GB_protein:AAF57073,REFSEQ:NP_733394,GB_protein:AAF57073,FlyMine:FBpp0085033,modMine:FBpp0085033; MD5=835ec7bd4b6efc5119b824aea611c103; length=534; release=r5.30; species=Dmel;
Sequence
MGYFIRCLLVMLFHSTLVLGHRPLEKSHSLSLVTMVPLLELEKKLIDNLENYTNALEQKL
EIIRSQLLVIRAENEKGRRNAISYLSNPLNGFSIIRRLHQDWINWRKYMEQPVGIWQLKA
FYSWKDELPTERDLWDACEGIARIQSTYDLKVGDFINGNINGKQYNDSMSTADILSVGAY
LFMKNRPSDAIQWLQEVPQRLQEELLIQPRHLPIKEVDALRLLAEAQIKDQNYSEALPLL
HNCLKLQPHDARVLRLWKKTTDFIENQPDQSPTENKKRNVPIANAFKLSCNGPLESSTRL
HCFYNFTTTPFLRLAPLKTEQIGLDPYVVLYHEVLSAREISMLIGKAAQNMKNTKIHKER
AVPKKNRGRTAKGFWLKKESNELTKRITRRIMDMTGFDLADSEGFQVINYGIGGHYFLHM
DYFDFASSNHTDTRSRYSIDLGDRIATVLFYLTDVEQGGATVFGDVGYYVSPQAGTAIFW
YNLDTDGNGDPRTRHAACPVIVGSKWVMTEWIREKRQIFIRPCLPKAKGTSTKS
Download sequence
Identical sequences Q9VA50
FBpp0085033 FBpp0085033 NP_733394.3.81976 FBpp0085033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]