SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085165 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085165
Domain Number 1 Region: 95-243
Classification Level Classification E-value
Superfamily ECOD 1.33e-90
Family ECOD 0.00016
Further Details:      
 
Domain Number 2 Region: 92-188
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.76e-22
Family Ribosomal protein L14e 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085165   Gene: FBgn0039857   Transcript: FBtr0085804
Sequence length 243
Comment type=protein; loc=3R:complement(27420646..27421185,27421243..27421323,27421770..27421880); ID=FBpp0085165; name=RpL6-PA; parent=FBgn0039857,FBtr0085804; dbxref=FlyBase:FBpp0085165,FlyBase_Annotation_IDs:CG11522-PA,GB_protein:AAF57166.1,REFSEQ:NP_733433,GB_protein:AAF57166,FlyMine:FBpp0085165,modMine:FBpp0085165; MD5=4f5c0a2419b0ee142378cf1ed6da540b; length=243; release=r5.30; species=Dmel;
Sequence
MAPIEKAKKVAKSAKKGKKHPVNSYLKGGILRYSKAQMYKRRALYRLKDKKSPVVEKAKV
PIKKSKASYPTKTFVKKRPSKANFSEHKRNTRRNLTPGTVLILLAGRHQGKRVVLLKVLA
SGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYFRRLKAKKDKKTG
EADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALHSSQYPHR
MRF
Download sequence
Identical sequences Q9V9W2
NP_733433.1.81976 4v6w_CE FBpp0085165 FBpp0085165 FR334 FR73

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]