SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085172 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085172
Domain Number 1 Region: 331-538
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-46
Family Ribonuclease PH domain 1-like 0.0000599
Further Details:      
 
Domain Number 2 Region: 48-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-40
Family Ribonuclease PH domain 1-like 0.0000709
Further Details:      
 
Domain Number 3 Region: 263-365
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 6.15e-24
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00058
Further Details:      
 
Domain Number 4 Region: 493-598
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.36e-23
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 5 Region: 181-271
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.49e-21
Family Ribonuclease PH domain 2-like 0.0034
Further Details:      
 
Domain Number 6 Region: 599-673
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000076
Family Eukaryotic type KH-domain (KH-domain type I) 0.0066
Further Details:      
 
Domain Number 7 Region: 670-751
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000303
Family Cold shock DNA-binding domain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085172   Gene: FBgn0039846   Transcript: FBtr0085811
Sequence length 771
Comment type=protein; loc=3R:complement(27227776..27228304,27228377..27229597,27229658..27230077,27230134..27230279); ID=FBpp0085172; name=CG11337-PB; parent=FBgn0039846,FBtr0085811; dbxref=FlyBase:FBpp0085172,FlyBase_Annotation_IDs:CG11337-PB,GB_protein:AAN14273.1,REFSEQ:NP_733429,GB_protein:AAN14273; MD5=eaa677588753b9382662be54b2695b71; length=771; release=r5.30; species=Dmel;
Sequence
MAMIFTRKSLKLLNYRLKCLSLSCPGGRRGIQSSSNGEAPSVEVNFSNGRNMTFSSGRLA
RFANGTAVCQMGDTAVMVTAVAKAKPNPGQGFMPLVVDYRLKNAASGRIPMNFMRRELGP
SEKEILSARLIDRSLRPLFHKDYRTETQLVCNMLAMDAVHSPDVLAINAASMALSLSDIP
WNGPIGAVRVGLCDGEVLINPTRRELQTSQLDLVVSATKQNLVVMLEGKGNVVLQQDLLK
AIKQGTREAQFIIHEIERLQKAYGRQKREVEVAAEVDPELGKAVRSMCEMRLREIFQDST
HDKMSRDNAVNEVRSNVIDKVWSSFPDTEPSLITEQFNQTSRTIFRELIFERGLRCDGRD
YDQLRNISCQVDMYKPLHGSALFQRGQTQVFCTVSLDSQESAMKLDSLAALDSGGLKAKN
FMLHYEFPPYATGEVGRIGPVGRREMGHGALAERSLLPTLPNDYPFTVRLTSEVLESNGS
SSMASVCGGSLALMDAGVPVSAPAAGVAIGLVTKFENDDTKHLQDYRILTDILGIEDYMG
DMDMKVAGTRKGFTAIQADLKIPGIPLKVVMESLQKATDAKSNILDIMSEAIREPRKYPK
ESWPVSETLTVEPQQRAQLIGPSGLHMKRIYLETGTSLTAVDETHFNVFAPSQAAMDEAK
ELIEGYMVKERVPDLEFGGIYTAKITELRDTGVMVILYPSMPPALLHNSQLDQRKIAHPS
ALNLEVGQEIQVKYFGRDPVSGFMRLSRKVLQGPALGIPRSLNKSAGESGT
Download sequence
Identical sequences Q9V9X7
7227.FBpp0085173 FBpp0085172 FBpp0085173 FBpp0290103 FBpp0085172 FBpp0085172 FBpp0085173 FBpp0290103 NP_001097990.2.81976 NP_001163783.1.81976 NP_651867.2.81976 NP_733429.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]