SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0085217 from Drosophila melanogaster FlyBase 5.12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085217
Domain Number 1 Region: 364-658
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.55e-80
Family beta-glycanases 0.000000145
Further Details:      
 
Domain Number 2 Region: 55-245
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.03e-48
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.000012
Further Details:      
 
Domain Number 3 Region: 248-362
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 2.73e-16
Family beta-Galactosidase/glucuronidase domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085217   Gene: FBgn0039874   Transcript: FBtr0085858
Sequence length 686
Comment type=protein; loc=3R:complement(27595195..27595370,27595430..27595568,27595623..27595884,27595940..27596256,27596314..27597480); ID=FBpp0085217; name=CG2135-PA; parent=FBgn0039874,FBtr0085858; dbxref=FlyBase:FBpp0085217,FlyBase_Annotation_IDs:CG2135-PA,GB_protein:AAF57195.1,REFSEQ:NP_651893,GB_protein:AAF57195,FlyMine:FBpp0085217,modMine:FBpp0085217; MD5=ec19e88e8c229dd03f2d68c109941632; length=686; release=r5.30; species=Dmel;
Sequence
MKSHWMPVTCLLLGSLQVLLAYTENDFLVNANRKELTDSPLFEYDNVRKPTPTKGLLYPR
DSETREVRSLDGMWQLVRSDPYDPLQGIREKWFMDALRKTGREIISMPVPASYNDITTDN
LRDHVGTVWYERTFFVPRSWKTMQRTWLRFSSVHYSAVVWINGRNATSHSIGHLPFESEI
SGLLSFGGDNRITVMCDNRLSNRTIPQGSVYKVATDDGTVPIQSYTFDFFNYAGIHRSVH
LYTTPLLHISDLEVTTQLTKEGLGRIDYRVWLDASKEGLQIQPIQLRVQLRDKDGHVAAQ
QINKAVYHGTLLVPNATPWWPYLMHSDPGYLYNLQFELFVASNEKELESLQDTYRLPVGI
RSLSWDNDSLLLNGKPLYLRGFGRHEDSDIRGKGLDNALLARDFNLLKWTGANAYRTSHY
PYSEESMQFADQHGIMIIDECPAVNIDIFEPQLLENHMSSLEQLIHRDRNHPSVVAWSVA
NEPRSNKQGALKYFEFLVNYVREIAHGRPLTAAINANSSSCHLAQFLDIVGFNRYNSWYQ
NSGRTDMILNLLTIEAQSWRDRFGKPVIQFEYGGDTMEGMHSLPAFIWSEEYQVELFSRH
FKAFDELRGRGWFIGEFVWNFADFRTAQTITRVGGNKKGVFTRNRQPKEVAHILRRRYFA
LAKELDMFGLPEDLTVYISKHIHNEL
Download sequence
Identical sequences Q9V9T9
FBpp0085217 NP_651893.1.81976 7227.FBpp0085217 FBpp0085217 FBpp0085217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]